KEGG   Stereum hirsutum: STEHIDRAFT_123822Help
Entry
STEHIDRAFT_123822 CDS       T03127                                 

Definition
(RefSeq) ATG16-domain-containing protein
  KO
K17890  autophagy-related protein 16-1
Organism
shs  Stereum hirsutum
Pathway
shs04136  Autophagy - other
shs04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:shs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    STEHIDRAFT_123822
   04136 Autophagy - other
    STEHIDRAFT_123822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shs04131]
    STEHIDRAFT_123822
   03029 Mitochondrial biogenesis [BR:shs03029]
    STEHIDRAFT_123822
Membrane trafficking [BR:shs04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    STEHIDRAFT_123822
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    STEHIDRAFT_123822
Mitochondrial biogenesis [BR:shs03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    STEHIDRAFT_123822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 Lectin_C YabA
Motif
Other DBs
NCBI-GeneID: 18797305
NCBI-ProteinID: XP_007307506
JGI: Stehi1_123822
Position
Unknown
AA seq 306 aa AA seqDB search
MAEPAWQELLRLRLTERNAKESSYAPIIEQYRRLAQQTKLLKERNASLLRAVASVKQNPS
SSTVFVPGTGEENPVRAAYISSLESQISSLRDELATVYKTQGQNAQRLLAMNETLREKEE
ISRMDSEALRRARDEAANLRRKVDQHAELMAEKDRTAQVLHDEISTLQLELGQIEERNQN
LTRDNAKLLQRWLDAKQAEVNKMNEANDFYVDMRTRHEAVLNWRDGSEASTSNAGDATTS
NTGDAAGATSSNTGDVDGQQTEQRQSGNAHASVSGNGSANGEGKGTGTRDGTKSQPEQTV
NLTPNG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccagcctggcaggagcttctgcgtctgcggttgacggagcgcaatgcgaag
gaatcctcgtatgctcctatcatcgagcagtatcggagacttgcacagcagacaaagttg
ctcaaggaacgtaatgcgtctttgctaagagctgttgcgagtgtgaagcagaacccgagc
agttctacagtcttcgtaccgggaacaggggaagagaaccccgtccgtgcggcatatatc
tcttcacttgaatctcagatatcatctctgcgcgatgaattagcgacggtgtacaagact
cagggccaaaatgcacagcgattactggccatgaacgagacactacgcgagaaggaggag
atatcaaggatggattcggaagctttgcggagagcgagagatgaggctgcgaacctcaga
cggaaagtagaccagcatgcagagctaatggcagagaaggaccggacggcccaggttctc
cacgatgagatcagcacgcttcagctcgaactcggccaaatcgaagaacgtaatcagaac
ctcacacgggacaacgctaaactcctccaacgctggctcgacgccaaacaagccgaagtc
aacaagatgaacgaagcgaacgatttttacgtcgacatgcgcacccggcacgaagccgtc
ctcaactggcgagatggctccgaggcctccacgtccaacgctggagatgccaccacgtcc
aatactggtgacgccgcgggtgctacgtcgtcgaacacgggtgatgtggacggtcaacag
acggagcagcggcagtcgggaaatgcgcacgcgtcggtgtcgggaaacgggagcgcgaac
ggagaggggaaggggacggggacgagggatgggacgaagtctcagccggagcagacggtg
aatctgacaccgaatggctag

DBGET integrated database retrieval system