KEGG   Stereum hirsutum: STEHIDRAFT_148616Help
Entry
STEHIDRAFT_148616 CDS       T03127                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
shs  Stereum hirsutum
Pathway
shs00500  Starch and sucrose metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STEHIDRAFT_148616
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     STEHIDRAFT_148616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 CBM_1
Motif
Other DBs
NCBI-GeneID: 18799824
NCBI-ProteinID: XP_007307222
JGI: Stehi1_148616
Position
Unknown
AA seq 514 aa AA seqDB search
MFRSTALLSFCLLAQRVLGQQVGTLTAETHPTLQVSECAAGGTCTSSSLPIVLDANWRWT
HSTTGSTNCYTGNEWDATLCPDDTTCAANCALDGADYSGTYGISVSGDALTLKFVTPNSN
GQNVGSRVYLMSSDTEYKEFNLLNQEFTFDVDMSTLPCGLNGALYFSQMDADGGMARFPT
NKAGAKYGTGYCDSQCPRDIKYIDGEANVAGWNGTSTNSGTGSMGSCCSEMDIWEANTMG
AAVTPHPCSLTEQTSCTGDDCGSPDRYAGVCDPDGCDFNSFRMGDESFLGPGLTIDTTQK
ITVVTQFITDDGTADGNLAQINRVYVQNGQVIQNSNSTIPGVTGNSITDDFCDAQKTAFG
DTNDFDKHGGLAQMGAAFKAGMVLVLSIWDDYAVNMLWLDSTYPTTDTAADPGAARGNCS
TTSGAPADVESSAASAAVIYSNIKYGPIGSTFSSTGTGTGGSSTASAPPTSTSSAAGAAQ
TKYGQCGGTGWTGPTACASGSTCTASNQYYSQCL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctctaccgctctcctctccttctgcctcttggctcagcgtgtcctcggccaa
caggtcgggactctcactgctgagacccaccccacccttcaagtctccgagtgcgctgct
ggtggaacttgcacgagctccagcttgcccatcgtcttggacgccaactggaggtggact
cactccactactggttccaccaactgctacactggtaacgaatgggacgccaccctctgc
cctgacgataccacctgcgctgccaactgtgcactcgacggtgctgactactccggcacg
tacggtatctccgtcagcggcgacgccttgactctcaagttcgttactcccaactccaac
ggccagaacgtcggatcgcgtgtctacttgatgtcctccgacactgagtacaaggagttc
aaccttctcaatcaggagttcaccttcgacgtcgacatgagcaccttgccctgcggcctc
aacggtgccctttacttctctcagatggacgccgatggtggtatggctaggttcccaacc
aacaaggccggtgccaagtacggaactggctactgcgactctcagtgccctcgtgacatc
aagtacatcgatggagaggccaacgtcgcgggctggaacggcacatccaccaactctggt
actggttccatgggttcttgctgctccgagatggacatctgggaggctaacactatgggt
gccgctgtcactcctcacccctgcagtcttactgaacagacttcctgcactggcgatgac
tgcggttctcctgaccgctacgccggagtttgtgaccccgatggttgtgacttcaactcc
ttccgtatgggcgacgagtccttcctcgggccaggcttgaccattgacaccacccagaag
atcactgtcgtcactcagttcatcaccgatgacggtactgccgacggtaacctcgcccag
atcaaccgtgtctacgttcagaacggccaagtcatccagaactctaactctaccatcccc
ggtgttactggtaactcgatcacggacgacttctgtgacgctcagaagaccgcctttggc
gacacaaacgacttcgacaagcacggcggtctcgctcagatgggcgctgccttcaaggct
ggcatggttctcgtcctctccatctgggatgactacgctgtcaacatgctctggctcgac
tccacctacccgacgaccgacaccgccgccgaccccggcgccgctcgcggaaactgctct
accacctccggtgcccccgctgacgtcgagtcctccgccgccagcgccgccgtcatctac
agcaacatcaagtacggccccatcggctccacgttctcgagcactggcactggtactggc
ggaagctccaccgcttctgctcctcccacgtctacctcttctgccgctggtgccgcccag
accaagtacggccagtgcggtggaaccggctggacgggacccacggcctgtgcctctggc
tcgacatgcacggcttccaaccagtactacagccaatgtctctaa

DBGET integrated database retrieval system