KEGG   Stereum hirsutum: STEHIDRAFT_168672Help
Entry
STEHIDRAFT_168672 CDS       T03127                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
shs  Stereum hirsutum
Pathway
shs00430  Taurine and hypotaurine metabolism
shs00460  Cyanoamino acid metabolism
shs00480  Glutathione metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    STEHIDRAFT_168672
   00460 Cyanoamino acid metabolism
    STEHIDRAFT_168672
   00480 Glutathione metabolism
    STEHIDRAFT_168672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shs01002]
    STEHIDRAFT_168672
Enzymes [BR:shs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     STEHIDRAFT_168672
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     STEHIDRAFT_168672
Peptidases and inhibitors [BR:shs01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   STEHIDRAFT_168672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 18803383
NCBI-ProteinID: XP_007304386
JGI: Stehi1_168672
Position
Unknown
AA seq 586 aa AA seqDB search
MRLTMRSSALSLLCGLSAIHSTAGVSIPRNQQESYKSTGKHGAVASEVAVCSESGVEMLK
MGGTAADAIIATALCVGTIAAYHSGIGGGGFMIVRSQNSSEHSYEMIDFRETMPGLGNET
MYVDSNDTTASTVGGLAVGTPGEMRGWEMLHNRHGKLPWATLFQPAIKLAGEGFKVTVDL
AAALSNTSYPFLTTDSRWAEIYAPNGSLLLENDTCYRKDYAKTLSTIAEQGPDAFYTGPI
AENVTAAAQARGGILQMSDLANYSAILRTPSNITYRDRYRIFSTIAPSSGSVVLSALKIF
EGYSGGAEPDDPAINLTTHRLIEGTKFAYGQRTTFGDPAFTANVSELEQYYLQESTAAAV
RAKISDNTTFAVEYYDPENYISLNDSGTSHMAAVDQWGNAVSLTTTVNFYWGSQVMTADG
IILNDEMDDFSSPGQTNGFGFTASPINYIKPFKRPQSSISSSIAEDLHTGELVMATGSAG
GSRIITATLQNLHHHLDQHMTAYESVHQSRWHDQLSGTTYFEIAAPNLGIAGFSNATVAY
LESMGYNVTYEDESGSTSHVIVKHLDTGLFEAANDPRKAAGAGVAY
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcacgatgcggtcgtctgcgctgtcgctgctctgcgggctctcagccattcat
agtactgctggagtgtctattcctcgaaaccagcaggaaagttacaaatctaccgggaaa
catggcgctgtagctagcgaagtcgcagtttgctctgagtctggggttgaaatgctcaag
atgggtggtacagcggcagatgcgattattgctacagcactttgcgtcggcactatcgca
gcctaccactccgggatcggaggaggtgggttcatgattgtacgatctcaaaatagttcg
gaacattcgtacgaaatgattgacttccgtgagacgatgcccggtctcggtaacgagacc
atgtacgttgacagcaatgatacgactgcttcaaccgtcggaggactcgctgtcggcaca
cccggcgagatgcgaggatgggagatgttgcacaaccggcacggaaagttgccatgggcg
acacttttccaacccgctatcaaactggcaggcgaaggcttcaaggtcactgttgacctt
gccgctgctctttcgaacacctcgtaccccttcctcacgaccgactctcgctgggccgaa
atttacgcacctaatggttcccttctgctggagaacgacacttgctaccgtaaagactat
gccaagaccctctccaccatcgccgagcaaggtcccgatgcattctacaccggtccgatc
gcggaaaatgtcacagctgctgcccaggcccgcggagggattctccagatgtctgacctc
gcgaactattcagctattctgaggaccccctcgaatatcacgtaccgggacagatacagg
atcttctcgaccatagcgccgagctcggggagtgttgttctcagcgctttgaagatattc
gagggttattctgggggtgcggagcccgatgacccagctatcaacctcaccacacacaga
ttgattgagggcacaaaatttgcgtacggccagcgcacgaccttcggcgaccctgcgttc
acagccaacgtctctgagcttgagcagtattatctgcaagaaagcaccgcagccgccgtt
cgcgcgaagatctcggataacaccactttcgccgttgagtactacgatccggagaactat
atctctctcaatgactccgggacatcgcatatggcggctgtcgaccagtggggcaacgcc
gtgtcgttgaccacgacggtaaacttctattggggcagccaagttatgactgcggatggt
atcattttgaacgacgaaatggatgacttctcgagccctggccagacgaacggctttgga
ttcactgctagccccatcaactacatcaaacctttcaaacgcccacaatcctccatctct
tcctcaattgccgaggacctccacaccggcgagctcgtcatggccaccggttctgccggt
ggctcccgcatcatcactgcaacgttgcaaaatttacaccaccacctcgaccaacacatg
accgcctacgagtcggtgcaccagtcccgatggcatgatcagctctcaggtacaacgtac
ttcgaaatcgcggcgccgaatttggggattgctgggttcagtaatgcgacggtggcgtat
ctggagtcgatgggatataatgtcacatatgaggatgagagcgggagtaccagtcatgtt
attgtcaagcatctggatacagggttgttcgaggcagcgaatgatccaaggaaggcggcg
ggggctggcgtggcatattag

DBGET integrated database retrieval system