KEGG   Stereum hirsutum: STEHIDRAFT_54879Help
Entry
STEHIDRAFT_54879  CDS       T03127                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
shs  Stereum hirsutum
Pathway
shs00052  Galactose metabolism
shs00500  Starch and sucrose metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    STEHIDRAFT_54879
   00500 Starch and sucrose metabolism
    STEHIDRAFT_54879
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     STEHIDRAFT_54879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18805400
NCBI-ProteinID: XP_007302356
JGI: Stehi1_54879
Position
Unknown
AA seq 544 aa AA seqDB search
MLGTLVVALSIALVSYGQSSTDDEPIPGDYSGALRPQIHYSPPVGFMNDPNGMFLDADGT
YHLYYQYNPTEIVAGNQHWGHATSQDLYHWTNQKIAIAPSGAEGEGIFSGSAVIDVNNTS
GFFPNQTDGVVAIYTLNTNTAQTQDIAYSVDGGYTFTKYENNPVIDVNSTQFRDPKVLWY
SAEDGTGWWSMVVAHAQDFVLTFYTSPNLREWTFASNFSHVGLLGLQWECPNLVTMPVEG
TDETMYLLFLSINPGAPLGGSISQYYPGYFNGTHFTPVDGVTRLSDFAKDNYAGQFFYGI
PEDQPAVSIAWASNWQYTEAVPTGAEGWRSSMSLPRLNTLKNVTRVGWDLVSKPYDLSPL
FDGEPLAQNENLGNGQVVVDYSNVTSGAVYFQANLTGIPTDGSSTGTLNFTFYSSVSGEN
ITGGFFLDGDTPFWIDRGSIRGFDNFWFTDKFLTNNLLLGGTGNWSLEAVVDRTLLEVFL
ADGERSGTVSFFPEERLDGLVVGTNGLNEGIEVSLVVRGLESAWADEEVGGGNGTVLGNV
TTSA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcactctagttgtcgctctgtcgatagctttggtctcttatggacagtcttcg
accgacgatgaacccattccaggcgactactctggagcactacgtcctcagatccattac
tctccgcccgtaggattcatgaacgaccccaatggcatgttcctcgacgcggacggaacc
tatcatctatattatcaatacaatcccacagagatcgtcgctggtaaccaacactggggc
cacgccacctcgcaggacctctaccattggacgaaccagaagattgccattgctccctct
ggcgcagagggagaaggcatcttttctggatcggctgttatcgatgtgaacaacacgtcc
ggattcttccccaatcaaaccgatggtgtcgtcgccatctatactctcaataccaacacc
gctcagacgcaagatatcgcatactccgtcgacggaggctacacgtttacgaagtacgag
aacaacccggtcatcgacgtcaactcgacacagttcagggatccgaaggtgctttggtat
tcagcggaagatggaacaggatggtggtctatggtcgtcgcacacgcgcaggatttcgtt
cttacgttctacacatcgccgaaccttcgcgagtggactttcgcgtcgaacttttcgcac
gttggactcctcggtctgcaatgggaatgtcccaacctcgtcacgatgcccgtcgaaggg
accgacgaaaccatgtacctcctcttcctctccattaatcccggcgcgccactaggcggt
tctatctcgcagtactaccccggctacttcaacggcacacatttcactcccgtcgacggc
gtcactcgtctctccgattttgcgaaggacaattacgccggtcaattcttctacggtatc
cccgaagaccaacccgccgtctccattgcctgggcgagcaattggcagtacacggaggct
gtcccgacgggtgccgagggctggagaagttcaatgtcgctacctcgtctcaacacgctc
aagaacgttacccgtgtcggctgggacctcgtttcgaagccttacgacctttcgcccctc
ttcgacggggagccgctcgcgcagaacgaaaatcttggcaatggtcaggtcgtcgtcgac
tattcgaacgtcacatccggcgctgtgtacttccaggccaaccttactgggatccctacg
gacggatcatccactggtacactcaacttcactttctactcctccgtcagcggcgagaac
atcaccggcgggttcttcctcgacggcgatacgccgttctggatcgatcggggctccata
cgcgggttcgacaatttctggttcacggataaattcttgacgaataaccttttgcttggt
gggacggggaattggagcctcgaggctgtggtggataggacgctgttggaggtgtttttg
gcagatggggagaggagcgggactgtgagctttttcccggaggagaggttggatgggtta
gttgttgggacgaatggtctgaacgaggggatcgaggttagtttggttgttaggggattg
gagagtgcttgggcggatgaggaggtggggggtgggaatgggacggttttagggaatgta
acgacgagtgcctga

DBGET integrated database retrieval system