KEGG   Stereum hirsutum: STEHIDRAFT_79891
Entry
STEHIDRAFT_79891  CDS       T03127                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
shs  Stereum hirsutum
Pathway
shs00100  Steroid biosynthesis
shs01100  Metabolic pathways
shs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    STEHIDRAFT_79891
Enzymes [BR:shs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     STEHIDRAFT_79891
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 18807126
NCBI-ProteinID: XP_007304666
JGI: Stehi1_79891
Position
Unknown
AA seq 447 aa
MSSLNPRTRSYEFFGPPGATAVTLGVPFLAYALFFACNEAAGGCPPPLDTLLPSFLHAVE
DPSWWANLWDPLAFALYFAWYTFCIVAWLVLPGDWVQGSQLRNGKYQHYKINAFATYLAA
LGIAAAVIFRYGYQSFTIFYDHWVGFTTAALANSVAQGLLWYALSFREGKLLALGGNSGN
PIYDFFIGRELNPTVGSLDIKSFNELRPGMILWQLILISMACEQATRRGGGITDSMGLVI
GFQSLYIADALYNEPAILTTMDITSDGFGFMLAVGDLLWVPFVYSLQARYLVFSPKELGP
YATAGILAVNCLGYYIFRSSNGEKNDFRNGKNPKSKLKHCITDSLTYGSLPRVDLQFMQT
ERGTKLITSGWWGMSRHPNYMGDLLMALAWSLPTGFDTPVTYFYVIYFAFLLIHRQLRDD
ENCERKYGKDWHKYMELVPWRIIPYVY
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtcctctctcaacccccgtacgcgttcgtacgagttcttcggtcctccaggcgccact
gccgtcacccttggtgtcccattcctcgcatatgccctcttcttcgcatgcaacgaggcc
gcaggcggctgtccacctcccctcgacaccctccttccttcgtttcttcatgccgtagaa
gacccttcctggtgggctaatctctgggatccactcgcctttgcgctatactttgcctgg
tacaccttctgtattgtagcctggctcgtcctgccgggagattgggttcaggggtcgcag
ctcaggaatggcaaatatcaacattacaagatcaacgccttcgcgacctatctcgccgcg
ctaggcatcgctgcagccgtcatcttccgctacggttaccagtctttcaccatcttttat
gaccactgggtcggcttcaccaccgcggcgttagccaattccgtcgcccagggtcttcta
tggtacgcgctgtcattccgggagggtaaacttctcgccttggggggcaactcaggaaat
cccatatacgacttcttcatcggtcgggagcttaaccccaccgttggaagtttggacatc
aaatccttcaacgaattacgtcctggaatgatcctttggcaactgatcctgatcagcatg
gcctgcgagcaggccacaagacgtggtggcgggatcaccgactctatgggccttgtcatc
ggctttcaatcgctatacatcgctgacgcgctctataacgagcctgccatcctcaccaca
atggacatcacatctgatggatttgggttcatgctcgcggtcggggaccttctatgggtt
cctttcgtctattctttgcaagctcgttatcttgttttcagtccaaaagagctcggtcca
tacgccaccgctggcatccttgccgtcaactgtctgggctattatatcttccgctcttcc
aacggcgagaagaacgacttccgtaacggaaaaaaccccaaaagtaaactcaaacactgt
atcactgattcactgacttacggaagccttcctcgcgtagatctccaattcatgcaaact
gaaagaggcacgaagctcataacatcaggctggtggggcatgtcccgccaccctaactac
atgggcgaccttttgatggccttggcgtggtctcttcccaccggtttcgacacacctgtc
acctacttctatgtcatctatttcgcgttcttgctcattcacaggcagttgcgcgatgat
gaaaactgcgagagaaaatatggaaaagattggcacaagtacatggaacttgtgccgtgg
agaattattccgtatgtctactga

DBGET integrated database retrieval system