KEGG   Sphingobacterium sp. ML3W: KO02_00830Help
Entry
KO02_00830        CDS       T03258                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
sht  Sphingobacterium sp. ML3W
Brite
KEGG Orthology (KO) [BR:sht00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KO02_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIM35366
UniProt: A0A088ESI4
Position
160608..160994
Genome map
AA seq 128 aa AA seqDB search
MTTQITEGIKISVACIFQPEYSNPEREHFMFAYQISIENLSDSSIQLISRYWNIFDSVGD
HNEIYGDGVVGEQPIIAPGQIHQYTSGCNLKSEIGYMEGYYNMVKLIDETTFQVDIPRFN
LIANYVLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaaataacagaaggaataaaaatttcagtagcatgcatttttcaacctgaa
tattcgaatcccgaaagagagcattttatgtttgcttatcaaataagtattgagaactta
agtgattccagtattcagcttatcagcagatattggaacatcttcgattcggttggtgat
cataatgaaatttacggagatggcgtggttggcgaacaacccataatagcgcccggacaa
atacatcagtatacatctggttgtaatttaaaaagtgaaatagggtatatggagggatat
tacaacatggtcaaattgattgatgaaacaactttccaagtcgatataccaagattcaat
ttaatagccaactacgtattaaattaa

DBGET integrated database retrieval system