KEGG   Sphingobacterium sp. ML3W: KO02_02105Help
Entry
KO02_02105        CDS       T03258                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00430  Taurine and hypotaurine metabolism
sht00460  Cyanoamino acid metabolism
sht00480  Glutathione metabolism
sht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KO02_02105
   00460 Cyanoamino acid metabolism
    KO02_02105
   00480 Glutathione metabolism
    KO02_02105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sht01002]
    KO02_02105
Enzymes [BR:sht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     KO02_02105
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     KO02_02105
Peptidases and inhibitors [BR:sht01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   KO02_02105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIM35592
UniProt: A0A088EVV9
Position
complement(443203..444900)
Genome map
AA seq 565 aa AA seqDB search
MKKYRFYIWITGAALFAQSCSVSHRLSKNPETFDKAAVVTAHPLASKVGVDILKMGGNAI
DAAVAVQFALAVVYPNAGNIGGGGFMVYRSNKGEVNALDFREKSPEKGYADMYLDKQGNV
IENLSVYGHLSAGVPGSVAGMVEAHNKYGKLDWKTLLAPAIALAQNGFQITKQQAEEFNH
FKESFEKYNPDGAPILKTTNWKTNDVFQQQELANTIKRIAEQGRDGFYKGITADLIVKEM
KSANGIINHNDLENYHAVWREPVTGYYRGHKIICMAPPSSGGPALVALLQSVAQFPLTKW
GFQSDSTIRVMVEAERRIYADRAAYLGDPDFIRVPVKELTDSIFNNNRLKAISLAKATPS
TDVKAAKFPGYESEETTHFSIVDPEGNAVSITTTLNNSYGSRVFVTGAGFILNDEMDDFS
VKPGVPNIYGLVGGKANAIEPNKRMLSSMTPTIVEKDKELYMVVGTPGGSTIMTSVFQTI
INVIDFHQNAQQSVTAPRFHHQWLPDHIDVEKKAIASKVRKSLENAGYKISPRGNIGRVE
NIIRLPNGKLQTGADPRGDDTAAGF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
ataaaaaaatacaggttttatatatggataacaggcgcagctttatttgctcaatcttgc
agtgtatcacatagactcagtaaaaatccagaaacatttgacaaagcagcagttgttacc
gctcatcccctcgcgtcaaaagtaggtgtagacatcttaaaaatgggaggaaatgctatt
gatgctgctgttgcagtacaatttgcattagccgttgtatacccaaatgcgggaaatatt
ggcggcggcggctttatggtctatcgaagtaataaaggcgaggtcaatgccttggacttt
agagaaaaatcgcccgaaaaaggatatgcagatatgtatttggataagcaggggaatgtc
attgaaaatttaagtgtttatggacatttgtccgctggagtacctggctctgttgcaggg
atggttgaagcccataataaatacggaaaactagattggaaaacattgctagctccagca
attgcattagctcaaaatggttttcaaatcaccaaacaacaagcggaagaatttaaccat
tttaaagaaagttttgaaaaatacaatcctgatggtgcacccatacttaaaacaacaaac
tggaaaacaaatgatgtatttcagcaacaagaactagccaataccattaaaagaatcgcg
gaacaaggtcgcgatggcttttataaaggtattacagccgacctgattgttaaagaaatg
aagagtgccaatggcattatcaaccataatgacttggaaaattaccatgccgtttggcga
gaaccagttacagggtactatcggggacataaaatcatatgcatggcgcccccttcaagt
ggcggccccgctttagttgcgctcttacaatctgtagcacagttcccgctaacaaaatgg
gggttccaaagtgattctaccattcgggtaatggttgaagcagaacgtcgtatttacgcc
gacagagcagcatacctaggcgaccccgacttcattcgcgtacccgtaaaagaacttaca
gattctattttcaacaacaacagattaaaagcgataagtttagcaaaggcgacaccaagc
acagatgtaaaagccgctaaatttcctggatatgaatcagaagaaaccacacattttagc
atcgtagaccccgaaggaaatgcagtttccatcaccactacacttaacaactcatatggc
tcccgtgtttttgtaacaggagctggttttatattaaatgatgagatggatgacttctcc
gttaaaccaggagttcctaatatctatggtcttgttggcggaaaagcaaatgcgattgaa
cccaataaaagaatgttaagctccatgacaccaacaattgtagaaaaagataaggaactc
tatatggttgttggaacaccaggaggctccaccataatgacctcagtcttccagaccatt
attaatgtcattgacttccatcaaaacgcgcaacaatcggttactgccccacgttttcat
catcaatggctaccagatcatattgacgtagagaaaaaagcaatagcatctaaagtaagg
aaatcattggaaaacgctggatacaaaatttctccacgcggtaatattggacgagttgag
aatatcatccgtttaccgaacggaaaattacagacaggtgcagaccccaggggtgacgat
actgcagctggtttttaa

DBGET integrated database retrieval system