KEGG   Sphingobacterium sp. ML3W: KO02_07120Help
Entry
KO02_07120        CDS       T03258                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
sht00260  Glycine, serine and threonine metabolism
sht01100  Metabolic pathways
sht01110  Biosynthesis of secondary metabolites
sht01120  Microbial metabolism in diverse environments
sht01130  Biosynthesis of antibiotics
sht01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KO02_07120
Enzymes [BR:sht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KO02_07120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIM36496
UniProt: A0A088EVJ8
Position
complement(1604714..1605739)
Genome map
AA seq 341 aa AA seqDB search
MYNFKNDYSEGAHPNILTKLIETNLVQQLGYGEDEYGIQAKEILKNKINNPFAAIHFLSG
GTQTNLIVISFLLRPHEAVISAKTGHIAANETGAIEATGHKVITVETTDGKLNPAAIEKA
LQEYALKPHVVKPRIVYISNSTEIGTIYLKKELEDLAACCLAHKLLLFLDGARLGHALMA
QDNDLTLTDIATLTDVFYIGGTKNGALLGEAVIFRDPHLAEDFEYVLKQRGAMLAKGRLL
AIQFLELFKEDLYFELADHANKMAMKIATTVKSKGFSFLTNSTTNQIFPILPKTVIAKLN
ENYLFFVWKEIDEDHAAIRLITSWATDEQYVDAFIADLKLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttcaaaaatgattattctgagggtgcacacccaaatattctaactaaacta
atagaaacaaacctcgtacaacaacttggatatggagaggatgagtatggaatacaagca
aaagaaattttaaaaaataaaattaataatccatttgctgccatacattttctttctgga
ggcacgcagaccaatcttattgttatttcctttcttttgcgtccacatgaagcggtcatc
agtgctaaaacaggacatattgcagcgaatgagacaggagctatcgaggctaccggtcat
aaagtcattactgtagaaaccacagatggcaaactaaatccagctgctattgaaaaagca
ttgcaagaatatgcactaaaaccacatgtagtaaaacctagaatcgtttatatttctaat
tccactgagataggtacgatatatctcaaaaaagaattagaggatctggcagcatgttgt
cttgcacataaactattgctatttcttgatggtgctcgattgggacatgctttaatggct
caagataatgatttgacacttacagatattgcaactttaacagatgtattctatatcggt
gggactaaaaatggtgctttattaggagaagctgttattttcagagaccctcatctggca
gaagattttgaatatgtactgaagcaaaggggtgcaatgttagctaaaggacgtctactt
gctatacagttccttgaattgtttaaggaagacctatatttcgaattggcagatcatgct
aacaaaatggctatgaaaatagcaactactgtgaaatccaaaggtttttcttttttaaca
aattctacaacaaatcaaatcttccccatattaccaaaaaccgtcattgcaaaactcaat
gagaattatttattctttgtttggaaggagatagatgaagatcatgcggcaattagatta
ataacttcatgggcaacagacgaacaatatgtcgatgcttttatcgcagatcttaaacta
ctctaa

DBGET integrated database retrieval system