KEGG   Staphylococcus hyicus: SHYC_01060Help
Entry
SHYC_01060        CDS       T03578                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
shu  Staphylococcus hyicus
Pathway
shu00780  Biotin metabolism
shu01100  Metabolic pathways
Module
shu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
shu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SHYC_01060 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shu01007]
    SHYC_01060 (bioF)
Enzymes [BR:shu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     SHYC_01060 (bioF)
Amino acid related enzymes [BR:shu01007]
 Aminotransferase (transaminase)
  Class II
   SHYC_01060 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJC95028
Position
249383..250495
Genome map
AA seq 370 aa AA seqDB search
MIFESYLNDLQSKGQYRQLREVATAHKQRISRDGKTWINFTSNDYLGLGQRHIDVMQLQK
RLDKYGAHLASSRLVSGHSKYYVDLEARIRDHYQFDEALLMTSGYDANLAIFQIFKQEKV
VVFSDALNHASIIDGIRLSQVQKVIFPHLNYDVLEHEMKQYPQHYKVIVTDSVFSTNGHT
ANLNRLRQLKETIGNTMIVIDDSHGFGLGYDMHYQDIDIVSTSLSKGLGAHGGLILCSSI
VKEMIVNTARPFIYSNCMPTMHLHLIESQLDALLQAEDARRLLHDNIAYFNAYARDNQGT
STAIKTFAIDDVHKANAVYQELMEAGIWVSFFRHPTVARPTLRMSLSSCHEKADIHHLMS
MLHDRGVGVV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgaatcttatttaaatgatttgcaatcaaaaggacaatatcgtcaattgagg
gaagtcgcaacggcgcataaacaaaggatttctagggatgggaagacttggattaacttc
acctcaaacgattacttaggtttagggcaacgtcacattgatgtgatgcaattacagaaa
cgtcttgacaagtatggggcccatcttgcgagttccagactcgtcagtggtcactccaaa
tactacgttgatttagaagcgcgtattcgtgatcactatcaatttgatgaagcgttacta
atgacgagtggttacgatgcgaatttagcgatatttcaaatctttaaacaagaaaaagtg
gtggtattttcagatgctttgaatcatgcgagcattattgatggcattcggttgtctcaa
gttcaaaaagtgatttttccacatttaaattatgacgttctagaacatgaaatgaaacaa
tatccgcaacattataaagtgattgttacggattctgttttttcaacaaatggtcatacc
gcaaatttaaatcgtttaagacaactcaaggaaaccatcgggaatacaatgattgtcata
gatgattcacatggatttggtttgggttatgacatgcactaccaagacatcgatattgta
tcaacgagcttatctaaaggtttaggtgcacatggtggtctaatattatgttcatcgatt
gttaaagaaatgattgtgaatactgcgcgacctttcatttattcaaactgtatgcctact
atgcatttacatttaattgaaagtcaattagatgcattgctacaagcagaggacgctcga
cgtttattgcatgataacattgcgtattttaacgcatatgctcgtgataatcagggtaca
tcaacagctattaaaacctttgctattgatgatgttcataaagcgaatgcagtatatcag
gaattaatggaagcgggcatttgggtgagcttttttcgacatccaactgttgcacgaccc
acgttgagaatgtcactgtcttcatgtcatgaaaaggctgatattcatcatctaatgtcg
atgttgcatgataggggtgttggtgttgtatag

DBGET integrated database retrieval system