KEGG   Staphylococcus hyicus: SHYC_02625Help
Entry
SHYC_02625        CDS       T03578                                 

Gene name
mqo1
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
shu  Staphylococcus hyicus
Pathway
shu00020  Citrate cycle (TCA cycle)
shu00620  Pyruvate metabolism
shu01100  Metabolic pathways
shu01110  Biosynthesis of secondary metabolites
shu01120  Microbial metabolism in diverse environments
shu01130  Biosynthesis of antibiotics
shu01200  Carbon metabolism
Module
shu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHYC_02625 (mqo1)
   00620 Pyruvate metabolism
    SHYC_02625 (mqo1)
Enzymes [BR:shu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SHYC_02625 (mqo1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJC95329
Position
600026..601528
Genome map
AA seq 500 aa AA seqDB search
MENLHNKTDVVLIGGGIMSATLGVLFKELQPEWDINVFERLDRCGKESSNVWNNAGTGHS
ALCELNYTNEMPDGTMDINKAIKVNEQFQISKQFWSYLVKTKKLTNPGAFIRTVPHMSFV
TGEKNVAFLEARVKALKENVLFSGMDITKDKDTLKKWVPLMMEGRPDSEIVAATRDESGT
DVNFGALTNQLMTRLEDQGGAIYYEHEVQTLKQNKDGSWRIQIKDLKEKKTFTVESKFVF
IGAGGASLPLLQKTHIPESKHIGGFPVSGLFLVCNNPDVVQQHQAKVYGKAKVGAPPMSV
PHLDTRYIDGERALLFGPFAGFSPKFLKTGSYFDLIKSVKPYNLTTMLAAGAKEMGLTKY
LIEQLMLSHSERVEELREFIPNAKEDEWEVVVAGQRVQVIKDTKEKGKGTLQFGTEVITS
KDGTLAALLGASPGASTAVAVMLNILQQSFKHEFTTWEPKIKEMIPSFGKELTNEIDLFK
SLNHDISKQLQLNEEGSLLS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacttgcataacaagacagatgtagtgttgattggcggaggcattatgagcgct
acattaggtgtattattcaaagaattacaaccagagtgggacatcaatgtatttgaaaga
ttagatcgttgcggtaaggaaagttcaaacgtatggaacaatgcggggactgggcattca
gcattatgtgaactgaattacacaaacgaaatgccggatggcacaatggatattaacaaa
gccattaaagtgaatgaacaatttcaaatatcaaaacagttttggtcttatttagttaaa
acaaaaaaattaacaaatccaggggcatttattcgtactgtaccacatatgagttttgtt
acaggggaaaaaaatgtcgcatttttagaggcccgtgttaaagcccttaaagaaaatgtg
ttgtttagtggtatggatattacaaaagataaagacactttgaaaaaatgggtgccgctc
atgatggaaggacgtccagattcagagatagtcgcagcaacacgtgatgaatcaggcact
gacgttaatttcggtgcgttaacaaatcagttaatgacacgattagaagatcaaggtggc
gctatttattacgaacacgaggtacaaacgttaaaacaaaataaagatgggtcttggcgt
atccaaattaaagacttaaaagaaaagaaaacatttactgttgaatctaagtttgttttt
attggtgcaggtggggcaagtttacctctgttacaaaagacgcatattccagagtcaaaa
catattggtggcttcccagtaagtgggctattccttgtatgtaataatccggatgttgtg
caacaacatcaagcaaaagtatacggtaaagcaaaagtgggtgcacctccaatgtctgta
ccacatttagacacgcgctatattgatggagaacgtgcattattatttggaccttttgca
ggattttcacctaaattcttgaagacaggctcatacttcgatttaattaaatccgtcaaa
ccatacaatttaacgacgatgcttgctgctggtgcaaaagaaatgggcttgactaaatac
cttatcgagcagctcatgttaagtcattctgagcgtgtagaagaactcagagaatttatt
cctaatgcaaaagaagacgaatgggaagtagttgtagcgggtcaacgtgttcaagtcatt
aaagatactaaagaaaaaggcaaaggaacgttacaatttggtacagaggtcatcacatct
aaagatggcacactagctgctttactaggggcatcaccaggcgcttcaacggcagttgca
gttatgctaaatattttacagcaatcatttaaacatgaatttacaacatgggaacctaaa
attaaagaaatgattccttcgttcggtaaagaactgacaaatgaaattgatttatttaaa
tcactcaaccatgatatttcaaaacagttacaacttaatgaagaaggtagtttattaagt
taa

DBGET integrated database retrieval system