KEGG   Staphylococcus hyicus: SHYC_10780Help
Entry
SHYC_10780        CDS       T03578                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shu  Staphylococcus hyicus
Pathway
shu00071  Fatty acid degradation
shu00280  Valine, leucine and isoleucine degradation
shu00310  Lysine degradation
shu00362  Benzoate degradation
shu00380  Tryptophan metabolism
shu00620  Pyruvate metabolism
shu00630  Glyoxylate and dicarboxylate metabolism
shu00640  Propanoate metabolism
shu00650  Butanoate metabolism
shu00900  Terpenoid backbone biosynthesis
shu01100  Metabolic pathways
shu01110  Biosynthesis of secondary metabolites
shu01120  Microbial metabolism in diverse environments
shu01130  Biosynthesis of antibiotics
shu01200  Carbon metabolism
shu01212  Fatty acid metabolism
shu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SHYC_10780 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SHYC_10780 (vraB)
   00640 Propanoate metabolism
    SHYC_10780 (vraB)
   00650 Butanoate metabolism
    SHYC_10780 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SHYC_10780 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SHYC_10780 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SHYC_10780 (vraB)
   00310 Lysine degradation
    SHYC_10780 (vraB)
   00380 Tryptophan metabolism
    SHYC_10780 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SHYC_10780 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SHYC_10780 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SHYC_10780 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shu04147]
    SHYC_10780 (vraB)
Enzymes [BR:shu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SHYC_10780 (vraB)
Exosome [BR:shu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHYC_10780 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJC96882
UniProt: A0A0A8HSD4
Position
complement(2213803..2214945)
Genome map
AA seq 380 aa AA seqDB search
MNKAVIVAAKRTPIGVYGGKLHKWEPEDLLKPLLQHFQKMLPCDLNTLDDVILGNVVGNG
GNIARKSFLEAGIDVRVPGLTIDRQCGSGLEAIQLACRLVESGAGDFYIAGGVESTSRAP
WKMKRPTSLYPSEPPQFFERASFAPSDQDPSMIEAAENVAHTFQITREDQDRFAYTSHIK
TAKAFENHQLDDEIVPLKVQGSWMTHDESVRPDIKLARLKRLKPLLPNGTVTVGNCCLKH
DGAALVVVMSQEKARTLGLSKGVYFKGYAIEGVAPTLLGSGPIPAVKELLEKHHLTITDI
DAVELNEAFSAQVLACQRELNISDAQLNRYGGAIAMGHPYSASGAILVTRLFYMTDAMRT
IATMGIGGGMGNAALFERWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcagtaatagtggcggcaaaacgaacgccgataggggtatatggtggtaag
ttacataaatgggaaccagaagatttactgaaaccattactgcaacattttcagaagatg
ctcccatgcgatttgaatacattggatgatgtcattttaggtaatgtggttggaaatggt
gggaatattgctcgcaaaagttttttagaagcaggcattgatgtacgtgtgcctggttta
accattgatcgtcaatgtgggtcgggtttagaggcgattcaattagcgtgtcgtcttgta
gaaagtggtgcaggtgacttttatattgctggaggtgtagagagtacaagccgtgcacct
tggaaaatgaagcgaccgacgtctctctatccttcagagcctccacaattttttgagcgt
gcctcattcgcaccaagcgatcaagatccgtccatgattgaggcagctgaaaatgtagct
catacctttcaaatcacgcgagaggatcaggacagatttgcatataccagtcacattaaa
actgctaaagcttttgaaaatcatcaacttgacgatgaaatcgtacctttaaaagttcaa
ggatcatggatgacgcatgatgaaagtgtacgtcctgatattaaattagcgcgcttaaaa
cgtttaaagccgttacttccaaatggcactgtaacagtagggaattgctgtttaaagcat
gacggggcagcgcttgtagttgtaatgtcacaagaaaaagcacgtacgcttggtctatct
aaaggtgtatattttaaaggctacgcgattgaaggggttgcgcctacgcttttaggaagt
ggacctattccagcggtaaaagaacttttagaaaagcatcatctgactataacagatatc
gacgcggtagagttgaatgaagcctttagcgcacaagtactcgcatgccaacgagagctt
aatatttctgacgcacaactcaaccgatacggtggcgctattgcgatgggacatccctac
agtgcaagtggggctattttagtgacgcgcttgttttacatgacagatgcaatgcggacg
atagcgacgatgggtattggaggaggcatgggtaatgcagcactgttcgaacgttggtca
tag

DBGET integrated database retrieval system