KEGG   Stella humosa: STHU_16410Help
Entry
STHU_16410        CDS       T06078                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
shum  Stella humosa
Pathway
shum00260  Glycine, serine and threonine metabolism
shum01100  Metabolic pathways
shum01110  Biosynthesis of secondary metabolites
shum01120  Microbial metabolism in diverse environments
shum01130  Biosynthesis of antibiotics
shum01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STHU_16410
Enzymes [BR:shum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     STHU_16410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BBK31007
Position
complement(1739546..1740604)
Genome map
AA seq 352 aa AA seqDB search
MNFASDNTAGAHPAVLQALAEASTGRAMPYGNDPWTDRVAARLAEIFETPVEIFPVATGT
ACNALALSALTPPWGAVYCHEQAHVEVDECGAPEMFTGGAKLVTLPGQDGRIAPETLAEA
LDRGGFGSVHSVQPSALSLTQSTECGTVYRPDHLRALCDLAHAKGLGVHMDGARFANAVA
ALGAAPADITWRAGVDVLSLGATKNGAMAAEAVVFFDRGRADRFAFRRKRAGHLFSKMRF
LSAQLEAYLADGLWLANAAHANAMATRLAAGLQGLPGVTLRHPVEANTLFAALPGPAIDA
MAAAGFRFYRWPDAGPDTIRLVTAFDTEAADVDAFLAKLQSILLIPAAATGT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgcctccgacaataccgccggtgcccatccggccgtgctccaggccctggcg
gaggcctctaccggccgcgccatgccctacggcaacgacccgtggaccgaccgggttgcc
gcgcgcctggccgagatcttcgaaaccccggtcgaaatcttccccgtcgccaccggcacg
gcctgcaacgccctggcgctcagcgcgctgacgccgccgtggggcgcggtctattgccac
gagcaggcgcatgtcgaagtcgacgagtgcggcgcgcccgagatgttcaccggcggcgcc
aagctggtgacgctgcctggtcaggacgggcggatcgcgcccgagaccctggccgaagcg
ctggaccgcggcggcttcggcagcgtgcacagcgtgcagccgtctgccctgtcgctgacc
cagtcgacagaatgcggcaccgtttaccggccggaccatctccgcgccctctgcgacctg
gcccatgccaagggcctgggcgtccacatggacggcgcgcgcttcgccaacgcggtggcg
gcactgggcgccgcaccggccgacatcacctggcgggccggcgtcgacgtgctgagcctg
ggcgccaccaagaacggcgccatggcggccgaggcggtggtgttcttcgaccgcggccgc
gccgaccgcttcgccttccgccgcaagcgcgcgggccacctcttctccaagatgcgcttc
ctgtcggcgcagttggaggcctacctggcggatggcctgtggctggccaacgccgcccac
gccaacgccatggccacgcgcctggccgccggcctgcaagggctgcccggcgtgaccctg
cgccaccccgtggaggccaacaccctcttcgcggccctgcccggccccgccatcgacgcc
atggccgcggcgggcttccgcttctaccgctggcccgacgccggccccgacaccatccgc
ctcgtcaccgccttcgacaccgaggcggccgacgtcgacgctttcctggcgaagctgcaa
tcaatcctcttgatcccggcggccgcaacgggtacttga

DBGET integrated database retrieval system