KEGG   Stella humosa: STHU_42650Help
Entry
STHU_42650        CDS       T06078                                 

Gene name
ftsZ1
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
shum  Stella humosa
Brite
KEGG Orthology (KO) [BR:shum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shum03036]
    STHU_42650 (ftsZ1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shum04812]
    STHU_42650 (ftsZ1)
   02048 Prokaryotic defense system [BR:shum02048]
    STHU_42650 (ftsZ1)
Chromosome and associated proteins [BR:shum03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    STHU_42650 (ftsZ1)
Cytoskeleton proteins [BR:shum04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   STHU_42650 (ftsZ1)
Prokaryotic defense system [BR:shum02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    STHU_42650 (ftsZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2 MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: BBK33631
Position
4501641..4503227
Genome map
AA seq 528 aa AA seqDB search
MPINLSVPSHDDVIKPRITVIGVGGAGGNAVNNMIRANLEGVEFVVANTDSQAIAQSLAT
RKLQLGASVTRGLGAGARPDVGRAAAEEALDELLDQIAGSNMVFITAGMGGGTGTGAGPV
IARAAREQGILTIGVVTKPFLFEGTHRMRAAEKGIEELQRFVDTLIIIPNQNLFRIANEK
TTFADAFKMADDVLHSGVRGITDLMVMPGLINLDFADIRTVMQEMGKAMMGTGEATGDKR
AIDAAEAAISNPLLDDVSMKGAKGVLINITGGLDMTLFEVDEAANRIRDEVDPDANIIFG
STFDEKLSGRMRVSVVATGMDVESAEKPRTVIQLVSDRDRAAQASVAAAEAPAPEPTRVA
EPVRSTAGGGGQGSAISLPLGGGGSSLPDSPPPAPRHSEVAQTSYVVESATEMPLSHESQ
TIHEEVPLRTAAGGGGFGSLIRRVTGLDRPRAPGLPAEKLDPAPMTPARPAAHQAPSHHA
PAHHAPAAPSAPTPAPRARATETVERNPPAGAEEDMLDIPAFLRRQAN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacctttccgtcccttcccacgacgacgtgatcaagccgcgcatcacggtg
atcggcgtcggcggtgccggcggtaacgccgtcaacaacatgatccgcgccaatctcgaa
ggcgtggaattcgtggtcgccaataccgattcgcaggccatcgcccagtcgctcgccacc
cgcaagctccagctcggcgccagcgtcacccgcggcctgggcgctggcgcccggcccgac
gtcggccgcgccgccgccgaggaggcgctggacgaactgctcgaccagatcgccggctcg
aacatggtgttcatcacggccggcatgggcggcggcaccggcacgggtgccggccccgtc
atcgcccgggcggcccgcgagcagggcatcctgacgatcggcgtggtgaccaagccgttc
ctcttcgaaggcacgcatcgcatgcgcgccgccgagaagggcatcgaggagctgcagcgc
ttcgtcgacacgctgatcatcatcccgaaccagaacctgttccgcatcgccaacgagaag
acgacgttcgccgacgccttcaagatggccgacgacgtgctgcattcgggcgtgcgcggc
atcaccgacctgatggtcatgccgggcttgatcaacctcgacttcgccgacatccgcacc
gtgatgcaggagatgggcaaggcgatgatgggcacgggcgaggcgacgggcgacaagcgc
gccatcgacgccgccgaggccgccatctccaacccgctgctcgacgacgtgtcgatgaag
ggggccaagggcgtcctcatcaacatcaccggcggtctcgacatgaccctgttcgaggtc
gacgaggcggccaaccgcatccgcgacgaggtcgaccccgacgccaacatcatctttggc
tccaccttcgacgagaagctgtcgggccggatgcgggtgtcggtggtggcgactggcatg
gacgtggaatcggccgagaagccgcgcaccgtcatccagctcgtcagcgaccgcgaccgc
gccgcccaggcatccgttgccgccgccgaggcgccggcacccgagccgacccgggtggcc
gagccggtgcgctcgacggccggcggcggcggccagggttcggcgatctcgctgccgctc
ggcggtggcgggtcgtccctgcccgacagcccgccgcccgcgccgcgccacagcgaggtc
gcacagaccagctatgtcgtggaatcggcgaccgagatgccgctctcccacgagtcgcag
accatccacgaggaagtgccgctgcgcaccgccgccggcggtggcggcttcggcagcctg
atccggcgcgtgaccgggctcgaccggccgcgtgcgcccggcctgccggccgagaagctg
gacccggcgccgatgacccctgcccgccccgccgcgcaccaggcgccgtcgcatcacgcg
ccggcccatcatgcgccggccgcgccgagcgcccccacgcctgccccacgggcgcgggcg
acggaaacggtcgaacgcaacccgccggccggcgccgaggaagacatgctggacattccg
gctttcctccgccgtcaagcgaactga

DBGET integrated database retrieval system