KEGG   Salinicoccus halodurans: AAT16_04215Help
Entry
AAT16_04215       CDS       T03940                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
shv  Salinicoccus halodurans
Pathway
shv00051  Fructose and mannose metabolism
shv01100  Metabolic pathways
shv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AAT16_04215
Enzymes [BR:shv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AAT16_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AKG73488
UniProt: A0A0F7HL19
Position
850465..851106
Genome map
AA seq 213 aa AA seqDB search
MLYAEERKKMCATVKIMFDRFQTNAAGGNLSLKVNDDHIIMTPTLMSQNYLCDLSPFQIL
VVDKDLNIIEGEGRLTREINMHMACYEENPDIKCVIHGHAKESMVWASIGENMPNVTEAT
QKLGEIKCLDYKPATTPELAESVRSYIKTRDSLPVALLLERHGILIMDKSIEKAYDMVER
LEYNAYVSYKMHVLSILGEEVSLEKQHEYNTTE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttatatgcagaagaaagaaaaaagatgtgcgcgacagtaaaaataatgtttgatcga
tttcaaactaacgctgccggtggaaatttaagtttaaaagttaatgatgatcatattatc
atgactccaactctgatgtcacaaaattatctttgtgatttaagtccatttcagatttta
gtcgtcgacaaagatttgaatatcattgaaggagaaggacgcttaactcgtgaaatcaat
atgcacatggcatgttatgaagaaaacccagatattaaatgtgttatacatggccatgca
aaagaatcaatggtttgggcaagtataggagaaaatatgcctaacgttaccgaagccact
cagaaattgggagaaataaagtgtcttgattataaaccggcaactactcctgaacttgca
gaaagtgttagaagttatattaagacacgagatagcctaccagtggctctgttattagaa
agacatggaatactcattatggataaaagtatagaaaaagcttatgacatggtcgagcgc
ctggaatataacgcatatgtctcctataagatgcatgttctatcaattttaggtgaagaa
gtttctctggaaaaacaacacgagtacaatactacagaataa

DBGET integrated database retrieval system