KEGG   Salinicoccus halodurans: AAT16_06055Help
Entry
AAT16_06055       CDS       T03940                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
shv  Salinicoccus halodurans
Pathway
shv00480  Glutathione metabolism
shv00590  Arachidonic acid metabolism
shv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AAT16_06055
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AAT16_06055
Enzymes [BR:shv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AAT16_06055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AKG73825
UniProt: A0A0F7D491
Position
complement(1227178..1227669)
Genome map
AA seq 163 aa AA seqDB search
MKTQFYDLEAKDDEGRLVRMSDFKGKVILIVNTASECGFKNQLSDLETLYQKYKDEGFVI
LAFPSDNFMNQEPLSAAEAKEHYNTDYGVTFRIMEKTDVIGKSIHPLYKYLTEGKSGLLI
NRIKWNYTKFLVSREGKIAYRYAPQRAPSSFEEDVKNLLRGLD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaattttacgaccttgaggcaaaagatgatgaaggccgcctcgtcagaatg
tctgacttcaaaggcaaagttattttaatcgtcaacactgcaagtgagtgcggattcaaa
aatcagctttcagacctcgaaacactttatcagaaatacaaagatgaaggattcgtcatt
ctggcttttccatctgataatttcatgaatcaggaaccgctgagcgctgccgaggccaaa
gaacattataacaccgattacggtgttacattcaggataatggaaaagaccgatgtcatc
ggaaaatccatacatcctctatacaagtacctgaccgagggcaaaagcggtctgctcatc
aatcgcatcaaatggaactatacgaaattcctcgtttcaagagaagggaagattgcttat
agatacgcaccccaaagagcaccttcgtcgtttgaggaagatgtcaaaaatctcttgcgt
ggtcttgactga

DBGET integrated database retrieval system