KEGG   Salinicoccus halodurans: AAT16_10560Help
Entry
AAT16_10560       CDS       T03940                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
shv  Salinicoccus halodurans
Brite
KEGG Orthology (KO) [BR:shv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:shv03009]
    AAT16_10560
Enzymes [BR:shv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AAT16_10560
Ribosome biogenesis [BR:shv03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AAT16_10560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 tRNA_anti-codon MaoC_dehydrat_N S4 S4_2 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AKG74593
UniProt: A0A0F7HM95
Position
2057979..2058866
Genome map
AA seq 295 aa AA seqDB search
MQKKAKSSELDAEWIVEEPTELLKFLFKMMPSKSRKSVKGILGRGQVVVNGEATTQFNDA
LQPGDRVQIHSRVADYAMKFTGVEILHEDDEIIVIEKEAGLLSIASEKERHLTAYRQLSD
YVQSVNADNRVFIVHRLDRDTSGIMVFAKSKAVQQKLQKSWQEVVSERTYIALVEGTVGK
SGKITSWLTEDKTFTMRSSRKPNNGQKAVTHYKVLKSNRNFSLLEVNLETGRKNQIRVHM
QDLGHSVIGDKKYGSRNNAIGRLGLHAHVLAFTHPKTGKTLRFESKIPTSFTRKV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaagcgaaatcaagtgaactggatgcagaatggattgtcgaggaaccaacg
gagctgctgaagtttttatttaaaatgatgccttccaagagccggaaatcagtaaaaggc
attttgggccgtggacaagttgttgtaaacggtgaagcgacgacacaattcaatgatgcg
ctccaacctggagaccgtgtgcaaattcattcacgcgtcgccgactatgccatgaaattt
acaggcgttgaaatcttacatgaagatgacgaaattatcgtaattgaaaaagaagcgggg
ctgctgtccatcgcatcagaaaaagaacgtcatttgaccgcctatcgtcaactgtcggat
tatgttcagagcgtcaatgccgacaaccgggttttcatcgtacaccgtttagaccgcgac
acttccggcatcatggtatttgcaaaaagcaaagcggtccaacagaaactgcagaaatcc
tggcaggaagttgtttcggaacgcacgtacatcgcactcgtggaaggcactgtaggaaag
agcggcaaaattacttcctggctgacggaagacaagacgttcaccatgcgctcgagcagg
aaaccaaataatggacaaaaagctgtaacccattacaaagtcttgaaatctaaccgcaac
ttttcattacttgaagtaaacttggagacgggacgtaaaaatcagatccgtgtccatatg
caggatttaggacattccgtcatcggtgataaaaagtacggttcccgcaataatgctatc
ggcagacttggattacatgctcatgttcttgcgttcactcacccaaaaaccggaaaaact
ttgcggtttgagtcgaagataccaacctcgtttacgcgcaaggtctga

DBGET integrated database retrieval system