KEGG   Shewanella sp. W3-18-1: Sputw3181_2459
Entry
Sputw3181_2459    CDS       T00453                                 
Name
(GenBank) DNA-binding protein
Organism
shw  Shewanella sp. W3-18-1
SSDB
Motif
Pfam: Phage_pRha ANT HTH_Crp_2
Other DBs
NCBI-ProteinID: ABM25283
UniProt: A0A6N3J5F9
Position
complement(2840959..2841633)
AA seq 224 aa
MKLITGNQLTMTSGEISDLVGSRHDKVKQSIERLAKNGVIQLPPMGVFENINSLSKNSKS
KHYVFSGEQGKRDSIIVVAQLSPEFTARLVDRWQELEAKQSKPYPQIPHSFAEALQLAAN
QAKLLEQQAPKVEFFDRLVVRDTLMNASQVAQKHNLSAVRLNKFLDEHDVYSHAIKRGRV
FQQWFIDKGFGKLRQTDQGFSQAMFTPAGEAWICEKLVSEGVAA
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaattaatcaccggtaaccaattgaccatgaccagtggagagatatccgacctagtt
ggatctcgtcatgacaaagtaaagcaatctatcgaacgcttggcaaaaaatggggtaatt
caacttcccccaatgggggttttcgagaatatcaatagcttaagcaaaaattcaaaatca
aaacactatgtattctctggcgagcaaggcaagcgtgatagtatcatcgttgttgcccag
ctttcacctgagtttaccgcaaggctggtcgatcgctggcaagagttggaagcaaagcag
tctaagccttacccgcagatcccgcattcatttgcagaagcactgcaactcgccgctaac
caagccaagctactcgagcaacaagcgcctaaagtggagtttttcgatcggctggtggta
cgtgacacattaatgaatgcaagccaagtggcgcaaaagcataacttgtccgctgttcgc
ctaaataaatttttggatgaacatgacgtttatagccacgccattaaacgcggcagagtg
tttcagcagtggtttattgataaaggctttggaaagctacgccaaacagaccaaggtttt
tcgcaggccatgtttaccccagcgggtgaggcgtggatttgtgagaagttagtgagtgaa
ggggtggccgcatga

DBGET integrated database retrieval system