KEGG   Shewanella sp. W3-18-1: Sputw3181_2461
Entry
Sputw3181_2461    CDS       T00453                                 
Name
(GenBank) lipoprotein, putative
Organism
shw  Shewanella sp. W3-18-1
SSDB
Motif
Pfam: SdrD_B SpaA CarboxypepD_reg CarbopepD_reg_2 NAD_synthase PPC
Other DBs
NCBI-ProteinID: ABM25285
UniProt: A0A6N3J5R0
Position
complement(2842441..2842959)
AA seq 172 aa
MKKLKLGLAAIVLISLAGCASQTVKLNAQFDAVEAKKLMEKGNNSIEGNAFLRQRGGGIV
TCSGMTVQLVPATAYATERALAYFGTTERGFAADEGIFNKKMPPRPADYDKYSKTTVCDS
EGRFKFKDLADGTYYVTTSITWMTGDYSRQGGLLLKRVYLQDGETAEVIMSQ
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaaaaacttaaattaggtttagctgctattgtgcttatttcattagctggctgtgca
tcacagacagtaaagttaaacgctcaatttgatgccgtggaagcgaaaaaattaatggaa
aaaggtaacaactccattgaaggtaatgcttttctacgccagcgtggcggcggcatagtt
acctgctctggcatgactgttcagctagtcccagcaactgcatacgccacagaacgcgct
ttagcatactttggtactacagagcgcggcttcgcggcagatgaagggatatttaataag
aaaatgccaccacgcccagcagattatgataaatattcaaaaacaacagtttgtgattca
gaaggtaggtttaagtttaaagatcttgccgatggtacttattacgtgacaacctcaatt
acttggatgactggcgactacagtcggcaaggtgggttattgctgaaaagggtttacctt
caagatggtgagactgccgaagtaatcatgtctcaatag

DBGET integrated database retrieval system