KEGG   Shewanella sp. W3-18-1: Sputw3181_2462
Entry
Sputw3181_2462    CDS       T00453                                 
Name
(GenBank) NLP/P60 protein
Organism
shw  Shewanella sp. W3-18-1
SSDB
Motif
Pfam: Prok-JAB NLPC_P60 RadC JAB
Other DBs
NCBI-ProteinID: ABM25286
UniProt: A0A6N3J623
Position
complement(2843046..2843759)
AA seq 237 aa
MHPTILHAFSQHAASCYPNECCGLLIKQGDKAQYVPCENKATNKADEFVIDPLQYAAIEE
QGQIIGICHSHPDASSKPSQRDIAMCEASGLPWHILSWPDGDLRTIAPTGERKPLLERPF
VHGVWDCYSCVRDWYSEVQQILLPDFERQDGWWEGEQELYLDNFAKAGFVALPNINLADL
QIGDVFLMQIQSQRVNHAAVYVGEGKILHHLYGRLSRYDIYGGYWQRNTRLIVRYTG
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcacccaaccattttacatgcctttagtcagcatgcggccagctgctaccctaatgaa
tgttgcggattgctgatcaagcaaggcgacaaagcgcaatatgtgccatgtgaaaacaag
gcaactaacaaagcagatgaatttgtgattgatccactacaatatgctgccattgaagaa
caagggcagatcataggcatctgccacagccacccagatgcgagcagcaagcctagccaa
cgtgatattgccatgtgtgaggcgagcggattgccttggcatatccttagctggcctgat
ggcgacttacgcaccattgcgccaacgggtgagcgcaaaccgctacttgagcgtccgttt
gtgcatggcgtatgggattgctatagctgcgtgcgcgactggtacagtgaggtgcaacaa
attctgttgccagactttgagcgccaagatggctggtgggaaggcgaacaagagctatat
ctcgataactttgccaaagcgggatttgtggcgctgccaaatatcaatctagccgatcta
caaattggcgatgttttcttaatgcaaatccaaagccagcgagtcaatcatgccgctgtt
tatgtcggcgagggtaaaatcctgcatcacctctatggccgtctaagtcgctatgatatc
tatggcggttactggcaacgcaacaccagattaattgtgcgttacacaggataa

DBGET integrated database retrieval system