KEGG   Shewanella sp. W3-18-1: Sputw3181_0527Help
Entry
Sputw3181_0527    CDS       T00453                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00010  Glycolysis / Gluconeogenesis
shw00020  Citrate cycle (TCA cycle)
shw00620  Pyruvate metabolism
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01130  Biosynthesis of antibiotics
shw01200  Carbon metabolism
Module
shw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sputw3181_0527
   00020 Citrate cycle (TCA cycle)
    Sputw3181_0527
   00620 Pyruvate metabolism
    Sputw3181_0527
Enzymes [BR:shw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sputw3181_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N HlyD_3 PYNP_C
Motif
Other DBs
NCBI-ProteinID: ABM23378
Position
567501..569510
Genome map
AA seq 669 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICAAVGDTLAADESIITVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAADPAPVAAPSSAPAAAPVQAAPAPAVPAATSTQAVET
KVVEVAVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKEVKV
AVGDKVSEGSLVIMLEVGGAAPAVAASAPTVAAQAAPAATVAPVAPASATPTASVVTVKE
IQVPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGD
KVSQGSVIATVETTAVGAAAPAPVAQAPAVQEVAPVAAQAPASRPPVPHHPSAGAPVSTG
AVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVGAGNG
GGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFR
KQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVD
TPNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAF
TPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGI
LSDIRTLIL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgacgaagtgcaagtgatc
gaaatttgtgccgctgtgggtgataccctcgcggccgatgaatcgattattaccgttgaa
agcgacaaggcgactatggatattcctgcgcctttcgccggtgtgttagccgagttaaaa
gtggctgtgggtgataaagtctctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgccgatcctgctccagttgcggcaccatcatccgcgccagcagctgcaccg
gttcaagcggctcctgctcccgcagtaccagcagcgacatcgactcaagctgttgagaca
aaagtcgttgaagtggctgtgccagatatcggtggcgacactgatgtctcggttatcgaa
gtgctggttgccgtcggtgataagattgaggttgatagcggtttaattactctcgaaact
gacaaagcgaccatggatgtaccttcaccttttgctggtgtggtaaaagaagtcaaagta
gccgttggcgataaagtgtcggaaggctctttagtcatcatgcttgaagtgggtggcgca
gctcctgctgtggcagcaagtgcgccaaccgttgccgctcaggcggctcctgccgctacg
gtagcgccagtggctccggcttctgcaactccaactgcaagtgtggttacggtaaaagaa
attcaagtgccagatattggcgatgcaagcaatgtcgatgtgattgaagtgctagtgtct
gtgggcgatatgatcacggccgaccaaggtttaataacccttgaaactgacaaagccacc
atggaagtgccagcgccatttgccggcaaactattgtcgttaaccgttaaagtgggtgat
aaggtttctcaaggtagcgtgatagctaccgttgaaacgactgctgttggagccgctgcg
cctgcgccagttgctcaagcgccagcagtgcaagaagtggcgccagttgctgctcaagca
cctgcaagccgtccgccagtgccgcatcatccaagtgcaggtgcgcctgtgtcgactggt
gcggtacatgcatcgcctgcggtacgccgtttagcccgtgaatttggtgtggatctcacc
caagtcactggttctggccgtaaaggtcgcattatgaaagaagacgttcaggcgtatgtg
aaatacgaactgtcgcgtccgaaagcaactgcggcaacgtcagtcggcgctggcaatggc
ggtggtctgcaagtgattgcagcacctaaagtggatttcagtaagtttggtgaagtggaa
gaaattccattaagccgtatccagaagatctctggccctaacttacaccgcaactgggtg
actattccgcatgtgactcagttcgatgaagctgatatcactgaaatggaagagttccgt
aagcagcaaaacgacgcagcggcgaagaagaaagccgattataagatcacgcctttagtc
tttatgatgaaagcggtggctaagacgttgcaacagttcccagtgttcaactcgagctta
agctctgatggcgaatcactgatccagaagaagtatttccacatcggtgtggcggtggat
acgccaaacggtttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgag
ttatctcgtgaactggctgatatctctatccgtgcccgtgatggcaagctgaaatctgct
gatatgcagggcagctgtttcaccatttcaagtttaggtggtattggcggtacggcgttt
acgcctatcgttaactacccagatgtggcgattttaggtgtgtctaaatctgaaattaag
cctaagtggaatggtaaagagttcgagcctaaattgatgttgccactgtcgctatcatac
gatcaccgcgtgatcgatggtgccatggctgcacgctttagcgtgaccctgtcaggaatt
ctgtccgatattcgtactttgattctgtaa

DBGET integrated database retrieval system