KEGG   Shewanella sp. W3-18-1: Sputw3181_0997Help
Entry
Sputw3181_0997    CDS       T00453                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00561  Glycerolipid metabolism
shw00640  Propanoate metabolism
shw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sputw3181_0997
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Sputw3181_0997
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Sputw3181_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Thiamine_BP
Motif
Other DBs
NCBI-ProteinID: ABM23847
Position
complement(1138754..1139872)
Genome map
AA seq 372 aa AA seqDB search
MSTVIPRTVTSPKKFIIGKGLLAQMHDYVKDFGDNAFIICDEFILSRVKNEAVAGLDQNG
ISSHLEQFNYECSEAEIKRLGALAEQHHTNVIVGVGGGKTLDAAKAVAFYQKRPVILYPT
IASTDAPCTALAVIYSETGEFERYLFLPQNPDAVVADTAIIAAAPARFFAAGIGDALATY
FEARACYQSDGVNLVLKKPSRTGLGLAQLCYQLLTENVEAAMDAVKNKIVTPALEQTIEA
TIYLSGVGAEAGGLAAAHAVNNGMSAVADLHKAQHGEKVVFGLLTQLVLENAPKAEIDNV
VRIIKTAGLPLTLADLGLKTFIEAEWRKVAEIACAEGDTMGNMPMKLTADDVYQAMIATN
AMAERYKTAEAC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtcattccacgtaccgtcacttcccctaaaaaatttattatcggcaagggc
ctattagctcaaatgcatgattatgttaaggactttggtgacaatgcttttatcatctgc
gatgaatttatcctcagccgcgtgaagaatgaagcggtcgctgggctagatcaaaatggg
atcagcagccacctcgaacaattcaactatgagtgcagcgaagccgagataaagcgctta
ggcgcgctggcagagcagcatcataccaacgtcattgttggagttggtggtggaaaaacc
ttagatgccgccaaagccgtcgccttctatcaaaaacggcctgtcatcttgtaccctaca
attgcctcaaccgatgcgccttgtactgcacttgcagtgatctactccgaaaccggtgag
tttgaacgctatctgtttctgccacagaacccagatgctgtcgttgccgacactgctatt
atcgccgcggctccggcccgattttttgcggcaggcataggcgatgcactggcaacctat
tttgaagctcgtgcctgctatcaatcggatggcgtcaacctagtcctgaaaaagccttcc
cgcacagggctgggattggcccaactttgttatcagttactgactgaaaatgttgaagct
gctatggacgcagttaaaaacaaaatagtcacacctgcgctagagcaaaccattgaagcc
accatctatctcagtggtgttggtgcagaagcaggcgggttagccgccgcccatgccgta
aataatggtatgtcagcggtggcagacttacataaagctcagcacggcgagaaagtcgtc
tttgggctgctaactcagctcgtgctcgaaaatgcccccaaagccgaaatcgataacgtt
gtccgcattatcaaaacagcgggactaccgctcactctcgcagatttagggctgaaaacc
tttatcgaggccgagtggcgcaaagtggctgagatagcctgtgctgagggcgatactatg
ggcaatatgccgatgaaattaaccgcagatgacgtctatcaagccatgatagccaccaat
gccatggctgaacgctataaaacagctgaagcttgttaa

DBGET integrated database retrieval system