KEGG   Shewanella sp. W3-18-1: Sputw3181_1179
Entry
Sputw3181_1179    CDS       T00453                                 
Name
(GenBank) Lytic transglycosylase, catalytic
Organism
shw  Shewanella sp. W3-18-1
SSDB
Motif
Pfam: SLT SLT_3 TPR_19 NAD_binding_4
Other DBs
NCBI-ProteinID: ABM24022
UniProt: A0A6N3J2S6
Position
complement(1330714..1331262)
AA seq 182 aa
MKTIKAKTVALVIAMSASTSVYAFPGYQWEKAAQSVGIDPVMLYAVALAESASHRGLNMT
SPWPYAIRNGSNATYAKSKTEAEQLLNQALQESEKYQLDIGLMQINLHWHGHRVSSAAEL
LDPITNLTVGSSILAEAIKSSPNDLELGIGRYHSWNEERARWYGQRVLSIYRNILHELEV
RQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaaaacgattaaagcaaaaaccgttgccctagtgatagccatgtccgcaagcacttca
gtctatgcgtttccgggctatcagtgggaaaaagcagcacaaagtgttggtattgatcca
gtcatgctctacgccgttgccttggctgagtccgcctcacatcgaggtcttaacatgacc
agtccatggccatacgcaattcgcaatggttcaaacgcaacctacgccaaatctaagaca
gaagcggagcaactgttaaaccaggcacttcaagagagtgaaaaataccagctcgatatt
ggccttatgcaaatcaatttgcattggcatgggcatcgagtgagctcagcagccgaactg
ctagaccccatcaccaaccttactgtcggctccagtattttggccgaagcaatcaagtct
tcaccaaacgatttagagcttggcataggccgctatcacagttggaacgaagagcgtgca
cgctggtatgggcaaagagtgctttctatctatcgcaatattttacatgaactggaggtc
cgtcaatga

DBGET integrated database retrieval system