KEGG   Shewanella sp. W3-18-1: Sputw3181_1606Help
Entry
Sputw3181_1606    CDS       T00453                                 

Definition
(GenBank) PHP C-terminal domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
shw  Shewanella sp. W3-18-1
Brite
KEGG Orthology (KO) [BR:shw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sputw3181_1606
Enzymes [BR:shw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Sputw3181_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ABM24443
Position
1831768..1832628
Genome map
AA seq 286 aa AA seqDB search
MNTQSILADLHSHTTASDGQLTPSELVARALEKGVQLFAITDHDTVAGLPEARAFNQAQA
APLKLISGVEISTRWNSYDIHIVALNFDADNLALLAFLENQRELRELRAQEIGHRLAKAG
IEGAYEGAKALAGDAALSRGHYARWMADKGHAVDMPSVFKRYLARGKTGYVPNNWGDMAS
AIEVIHNAGGLAVLAHPSGYKLSAKWLKRLVREFKEAGGDAMEVVLGQQTLDDRANLVAL
SVQNQLLASIGSDFHFPSNWIELGKNLYQPQGIDWVWQSRSWMERP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaaagcatattggctgatttacacagccacacgaccgcgtccgatggtcag
ttaacgccgtctgaattggtagcaagagcccttgaaaagggcgtgcagttatttgcgatc
accgatcacgacactgtggcaggtttacctgaagcccgtgcctttaatcaggcacaagct
gcaccattgaaattgatttctggcgtggaaatctctactcgctggaatagttacgatatt
catatcgtggcgcttaacttcgatgccgataacctcgcgctattagcatttttagaaaac
cagcgtgaattacgtgaattacgtgcccaagaaattggccatagattagctaaagctggt
atcgaaggtgcctacgaaggcgctaaggcgttggcgggtgatgccgcgttgagccgtgga
cattacgctcgctggatggctgataagggtcatgctgtggatatgccgagtgtatttaaa
cgctatttagctcggggtaaaaccggttatgtgcccaataattggggcgatatggctagc
gcgattgaagtgatccataacgcgggcgggttagctgtgttagcccaccctagcggttac
aagttatccgctaagtggcttaagcgcttagtgcgcgaatttaaagaagcaggtggagat
gccatggaagtggtactcggccagcaaacgttagacgacagggccaatcttgtggcgctg
agcgttcaaaaccagttgcttgcatcgatagggagtgattttcactttccaagcaattgg
atagaattaggtaaaaatctgtatcagccccaaggtattgattgggtctggcaatcgaga
tcttggatggaacgaccatga

DBGET integrated database retrieval system