KEGG   Shewanella sp. W3-18-1: Sputw3181_1868Help
Entry
Sputw3181_1868    CDS       T00453                                 

Definition
(GenBank) SSU ribosomal protein S6P modification protein
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
shw  Shewanella sp. W3-18-1
Brite
KEGG Orthology (KO) [BR:shw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:shw03009]
    Sputw3181_1868
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Sputw3181_1868
Ribosome biogenesis [BR:shw03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Sputw3181_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST Dala_Dala_lig_C Glyco_trans_4_2 ATPgrasp_YheCD R2K_3
Motif
Other DBs
NCBI-ProteinID: ABM24703
UniProt: A1RJ58
Position
2150703..2151608
Genome map
AA seq 301 aa AA seqDB search
MRIAILSQGPELYSTKRLVEAAQLRGHEVHVINPLECYMNINMRQSSIHIGGRELPTFDA
VIPRIGASITFYGSAVLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFA
NKPSDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRKAAESVIEAFMGLKANIMVQEYI
KEANGADIRCFVLGDKVIAAMKRQAMPGEFRSNLHRGGTASLVKLTPEERSVAIRAAKTM
GLNVAGVDLLRSNHGPVIMEVNSSPGLEGIEGATTKDVAGAIIEFVEKNVTKVKKVTQAQ
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgcgatcctatcgcaagggcctgagctatattcaactaagcgactcgttgaa
gcggctcaactacgtggtcatgaagtacacgtaattaatccccttgaatgttatatgaat
atcaacatgcggcaatcgagtattcatattggtgggagagaacttcctacgtttgatgca
gtgatcccccgtattggcgcatcgatcaccttttatggttcggcggtgctgcgtcagttt
gagatgatgggggtctatgctttgaatgattccgttggcatctcccgttcacgtgacaaa
ttacgttcaatgcagttgatgtcacgtcgtggaattgggttaccaattacagggtttgct
aataaacccagtgatattcctgacttaattgatatggtgggtggtgcgcctcttgttatc
aaattgcttgaaggcacacaaggaattggcgtggtcttagcagaaacccgtaaagctgcc
gagagtgtcattgaagcctttatgggccttaaagccaatatcatggtgcaagaatatatt
aaagaagcaaatggcgcggatattcgttgttttgtgctcggtgataaagtgattgccgcc
atgaagcgtcaagctatgccaggtgagttccgctctaacttgcaccgtggtggtaccgca
agtttagttaaacttacgcctgaagagcgctccgttgctattcgtgcagctaagactatg
ggactgaatgtggcaggtgttgatttgctacgctcgaatcatggccccgtcataatggaa
gtgaattcctcccctgggcttgaagggattgaaggtgccaccactaaagatgtggcaggt
gcgattattgaatttgttgaaaaaaatgtgactaaagtgaaaaaggtgactcaggcgcaa
ggttaa

DBGET integrated database retrieval system