KEGG   Shewanella sp. W3-18-1: Sputw3181_2704Help
Entry
Sputw3181_2704    CDS       T00453                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00071  Fatty acid degradation
shw00072  Synthesis and degradation of ketone bodies
shw00280  Valine, leucine and isoleucine degradation
shw00310  Lysine degradation
shw00362  Benzoate degradation
shw00380  Tryptophan metabolism
shw00620  Pyruvate metabolism
shw00630  Glyoxylate and dicarboxylate metabolism
shw00640  Propanoate metabolism
shw00650  Butanoate metabolism
shw00900  Terpenoid backbone biosynthesis
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01130  Biosynthesis of antibiotics
shw01200  Carbon metabolism
shw01212  Fatty acid metabolism
shw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sputw3181_2704
   00630 Glyoxylate and dicarboxylate metabolism
    Sputw3181_2704
   00640 Propanoate metabolism
    Sputw3181_2704
   00650 Butanoate metabolism
    Sputw3181_2704
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sputw3181_2704
   00072 Synthesis and degradation of ketone bodies
    Sputw3181_2704
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sputw3181_2704
   00310 Lysine degradation
    Sputw3181_2704
   00380 Tryptophan metabolism
    Sputw3181_2704
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sputw3181_2704
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sputw3181_2704
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sputw3181_2704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shw04147]
    Sputw3181_2704
Enzymes [BR:shw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sputw3181_2704
Exosome [BR:shw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sputw3181_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABM25523
Position
complement(3081660..3082850)
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQEIVIVAAKRTPMGGFQGSLSSVASPTLAATAIKGLLVETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARSGMRMGHGKMLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKAEITPVTVSDRRGDVTVDTDEQPGNARPEKIPTLRPAF
SKDGTITAANSSSISDGAAALMLTSRGEAERLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDVAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKTRGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagagatcgttattgttgccgctaaacgcacccctatg
ggtggttttcaaggcagtttgtcatccgttgcatcaccgactctagccgcgacagccatt
aagggcttgttggtggagactcaattggcgggtgagcatgttgatgaagtcttgatgggc
tgtgtattacccgcaggtttaggtcaagcgcctgcacgtcaggccactttaggtgcgggg
ctaccactttcagtgggggcgactactgtgaacaaagtatgcggttcaggcatgaagacg
gtcatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgctggcggt
atggaaagcatgagccaagcaccatatctcttggataaagcccgtagcggcatgcgtatg
ggccacggcaaaatgctcgaccatatgtttttagacggtcttgaagatgcctacacgggt
ggcgctatgggaacgtttgcccagaaaaccgccgatgaatttggtatcacccgcgagcag
atggatgctttcgccctaagctcgctcgaaaaagccaatgccgcgattaactcgggcgcc
tttaaggccgaaattaccccagtcacagttagtgatcgtcgcggtgatgtgactgtcgac
accgacgagcaacccggtaatgctcgaccagaaaaaattcctacgctgcgcccagctttt
agcaaagatggcactatcacagcggctaactctagctcgatttccgatggcgcagcggca
ttgatgctgacctctcgcggcgaagctgagcgtttaggcttaactgtattagccaccatc
aaaggccacacgacccacgcccaagagccttcactctttaccactgcacctgtcggcgct
atggcgaaattactggccaatgtcggttggtcaacggatgaagttgatttattcgaaatc
aacgaagccttcgccatggtgactatgcttgccgtgtctgaactgggtttagatgtggct
aaagttaacgtcaatggcggcgcctgcgccttaggtcatcctattggctgctcgggttca
cgtttgctggtgaccttaatccatgctttaaaaacccgcggccttaaacgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggccatcgaggtctaa

DBGET integrated database retrieval system