KEGG   Shewanella sp. W3-18-1: Sputw3181_3722Help
Entry
Sputw3181_3722    CDS       T00453                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00300  Lysine biosynthesis
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01130  Biosynthesis of antibiotics
shw01230  Biosynthesis of amino acids
Module
shw_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sputw3181_3722
Enzymes [BR:shw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Sputw3181_3722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N DUF1955
Motif
Other DBs
NCBI-ProteinID: ABM26528
Position
complement(4249599..4250843)
Genome map
AA seq 414 aa AA seqDB search
MDHFLYHNNALHAEGCQVADLAKTYGTPLYIYSRATLERHWHAFNNAVMDHPHLICYAVK
ANANLAVLNVLARLGSGFDIVSGGELARVIEAGGSPAKVVFSGVGKTVAEMEQALNLGIY
CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI
VFARAHALPHLKVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL
GVTYDDETPPHPDVYAAALLKRLGNRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKRF
AIVDGAMNDLIRPALYSAWQNIIPVVPRDSEAYEFDIVGPVCETGDFLGKERKLALAAGD
LLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEHAFLVREREKISQLWQGEQLLP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttggatcactttctctaccataataatgccctgcacgccgaaggctgtcaggttgctgat
ttagccaaaacctatggcacaccactatatatatattcccgtgcgacacttgagcgccat
tggcatgcttttaataatgccgttatggatcatccacacctcatttgttatgcggtcaaa
gccaacgctaacttggccgtactgaatgtgctggcacgtttaggcagtggttttgatatt
gtgtctggcggtgagttggcaagggttatcgaagcaggaggctcccccgctaaagtggtg
ttttctggtgtgggaaaaaccgttgccgagatggagcaagcgcttaatctgggtatttac
tgttttaacgttgaatcaagcgccgagcttgagcagttaaatctggttgcgggtcgttta
ggtaaagtagcacccgtttcattgcggattaatcccgatgtggatgcaggaacccatccc
tatatttcgaccggccttaaggaaaacaaatttggcattgctatggatgaggctgaaatt
gttttcgcccgtgcccatgcgttaccacatctaaaagtgaaaggtgtcgattgtcatatc
gggtcacaactcactgagatccaaccatttcttgatgcaatggatcgtatgctggcgctc
atagatcgtctggctgagcaaggaattgttatcgaacatttcgatgtaggcggtggttta
ggagtgacctatgatgatgaaacgccaccacatcccgatgtatatgcggctgcgttactc
aagcgtttaggcaaccgtaaacttaaactgattttcgagcctggccgtgcgattgcagct
aatgcggggatttttgtcactcaggtgctttatctgaaagaaaacagcgacaagcgtttt
gcgattgtcgatggcgcgatgaatgacctaattcgccccgcactttacagtgcatggcaa
aatattatcccagtagtgccaagagactctgaggcctatgaatttgatattgtaggccct
gtgtgtgaaacaggcgattttctaggtaaagaacgcaagctggctttagctgctggcgat
ctacttgcggtgcgttcaagtggtgcctatggttttgctatggcatccaattacaatact
cgtccccgtgcggctgaagtgatggtcgatggcgagcacgctttcttagtgcgtgagcga
gaaaaaatatctcaactctggcaaggtgagcaactcctgccgtaa

DBGET integrated database retrieval system