KEGG   Shewanella sp. W3-18-1: Sputw3181_3770Help
Entry
Sputw3181_3770    CDS       T00453                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00230  Purine metabolism
shw01100  Metabolic pathways
Module
shw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sputw3181_3770
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sputw3181_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 ABC_tran Peptidase_M28 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: ABM26575
Position
4317231..4317854
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVDGQHYHFVNVE
QFKTLIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAEQVKAVMPEAVG
VFILPPSKAELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEYDFIIINDDFDTALADLR
AIIRSQRLTGASQIHAQNDMLHDLLAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtgtcagcgccaagtggtgcgggtaaatcctcg
ctaatttcggcattgttaaaagacaaacctgccgatatgcaggtttcagtatcacatact
acccgcgcgccgcgcccaggtgaagttgatggccaacactaccacttcgttaatgttgaa
caatttaaaacattaatagctgaaaatgcctttttcgaatgggctgaagtattcggtaat
tactatggtacatcacgccatgtgatcgaacatacgctcacccaaggtatcgatgtgttc
ctcgatatcgactggcaaggtgccgagcaggttaaagcggttatgcctgaagccgtaggg
gtatttattttaccgccctcgaaagctgaactagagcgacgcctgactggtcgaggacaa
gacagtcaggaagtgattgccagccgaatggcacaagccgtatcggaaatgtcccactat
aaagaatatgattttattatcatcaatgatgattttgatacagcactggccgatctgcgt
gccatcattcgcagccaacgcttaacaggtgctagtcagatccacgcacaaaatgatatg
cttcacgatctgttggcaggatag

DBGET integrated database retrieval system