KEGG   Schistosoma haematobium: MS3_00143Help
Entry
MS3_00143         CDS       T05004                                 

Definition
(RefSeq) Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
shx  Schistosoma haematobium
Pathway
shx00020  Citrate cycle (TCA cycle)
shx00640  Propanoate metabolism
shx01100  Metabolic pathways
shx01200  Carbon metabolism
Module
shx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MS3_00143
   00640 Propanoate metabolism
    MS3_00143
Enzymes [BR:shx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MS3_00143
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MS3_00143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 24587988
NCBI-ProteinID: XP_012791798
UniProt: A0A095BT63
Position
Unknown
AA seq 347 aa AA seqDB search
MLDSFQYHNRCNNNLQKNVLKIFVFAFSNCLVSVVIGLVRRSCYNSTRRNILLDDKTKLI
CQGFTGKQGTFHSQQTLAYGTKLVGGVSPGKGGSSHLGLPVFNTVNEAKEATGATATVIY
VPPPHAAAAIHEAIDAQVPLIVCITEGIPQHDMIRVRKRLSEQSASRLIGPNCPGIIKPD
VCKIGIMPAHIHKPGTVGIVSRSGTLTYEAVFQTTQVGLGQSLCIGIGGDPFNGTNFTDC
LEVFLNDPNTKSIILLGEIGGDSEEQAAEFLKEHNTGPNRKPVVSFIAGVTAPPGRRMGH
AGAIISLGKGGAKEKMAALESAGVVVTPSPAQIGKTLLQAIADLPNS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctagatagttttcagtatcataaccgatgtaacaataatttgcaaaagaatgttttg
aaaatatttgtatttgctttctctaattgtcttgtttctgtagttataggattggttcgt
cggtcatgctacaatagtactcgcagaaatatactgttggatgacaagactaaattgata
tgtcaagggtttacggggaaacaaggaacttttcattctcagcaaactcttgcttatggc
acgaaacttgtgggtggagtttcacctggtaaaggaggcagttcccatcttggattacct
gttttcaacactgtgaacgaggctaaggaagctacaggtgcaacagccactgttatttac
gtgccgccacctcatgctgccgctgctatccatgaagctattgatgcacaggttcctctt
attgtctgtataaccgaaggtatcccacaacatgatatgatacgtgtacgaaagcgtctt
tctgaacagtctgcctcaagattaattggaccaaattgtccaggaataataaaaccggac
gtatgcaaaattggtattatgcctgcacatattcataaaccaggaacggtaggaatagta
tccagatcggggacattaacttacgaagctgtctttcaaactacacaggttggtcttggt
caatccctgtgtattggaatcggtggcgatccatttaatggaacaaacttcaccgactgt
cttgaggtgtttttaaacgatcctaatacaaaatcaataatcctgcttggcgaaatcggt
ggtgactcagaagaacaagctgccgaattcttaaaagagcataatactggtccaaaccgc
aaaccagttgtatcttttattgccggtgttacagcgccacctggacgtcgtatgggtcat
gctggagctatcatttcgctaggtaaaggtggtgctaaagagaaaatggcagctttagaa
agtgcaggtgttgttgtcacaccttccccagctcaaataggtaaaactctcttgcaagcc
attgcagatcttccaaactcgtaa

DBGET integrated database retrieval system