KEGG   Schistosoma haematobium: MS3_00167Help
Entry
MS3_00167         CDS       T05004                                 

Definition
(RefSeq) Insulin-degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shx01002]
    MS3_00167
Enzymes [BR:shx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     MS3_00167
Peptidases and inhibitors [BR:shx01002]
 Metallo peptidases
  Family M16: pitrilysin family
   MS3_00167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 24588010
NCBI-ProteinID: XP_012791821
UniProt: A0A094ZE51
Position
Unknown
AA seq 917 aa AA seqDB search
MDCMNSVDSSSPVVQKSANDLREYKVVRLCNRMKVLLISDPETDKSAVCLSVNIGSLSDP
KELPGLAHFCEHMLFLGTKSFPTENTYLKYITDHGGHCNAFTSPDRTSYVFDVAPESLKG
ALDIFSQFFICPLFTDSATEREVSAVQSEHEKDISNDTRRLFQLERSLSKSGHDYTKFLS
GNRYSLFESSCAQSVNTREKLLQFYSTWYSSNVMGLVILGRESINDLEKLAEDKFSEVID
RNVVQQSWNDTPWPDICLKKMVYVVPLNDVHQMNIMWPIPDYIPDYTAQAPSYVTHLLGH
ESRGSLLSLFKNAGWANRLACGVSRPAAGICSLILSIDLTLKGLDKTDEIMTNVYQYINM
LRSDEPQKWIFDEEQALCQLNFRFKDKEPPYEYVTGLAGNLLLYDMQDVLTGSFLATVYN
PDLIKKIISCLTPDNSRYVIFVFYNVFDLQYRVNICRFEYMVSHVLPSDNQSAWRNSSSN
PELRFPEPNSFIATEFDLVQNKCPTNVEMPELLIETEMSRIWYFQDTEFNLPKGFITFHI
VSPFAFFDPFHTSLGLIYANLFEDHINELTYSSMLAGMTVYVKHTVEGIKLSFLGYSHKL
KSFVKEIVTKFVNYYQPVTDRFECIRENMSREFSNFSMKPAYQQSGAYLTSLISDHSWIS
DDFVRAFKEVTYERLINFIMEFHERIFIEGLIYGNITEEDAISYHEMVRDLLVQKMNSKP
LLLSHILTSREVIIPEDSSFLYQRYISGQPASAIYYYLQCGEQSTFNDTLLNLFCQIVSE
PVFNKLRTEQQLGYVVQAGLRRSNKLQGFRILVQSSYHPNKIDKCIEEFLLTVNKLLEDM
SDEEFNVHVRSLMTHLLEKPKGMQDRFGRLWSEIACRHYNFKRHLHEAGVLKSLKKNDVI
DFFRVRVTQQDTFRSYF
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggattgtatgaattcggtagattcttcatctccagtagtgcaaaagtctgcaaatgac
ttgagagaatataaagtggtgcgtttatgcaataggatgaaagtgcttctcataagtgat
ccggaaacagataagtctgcagtgtgtttatctgtgaacattggttcactgtcggatccg
aaagaactgcctggtctcgcacacttttgtgagcatatgttgtttcttggtacgaaatca
tttccaacagaaaatacctatttgaagtacataaccgatcatggtggtcactgtaatgct
tttacgagtccagatagaacttcttatgtgtttgatgttgcacctgaaagtttgaagggt
gcgttggatattttctcacagtttttcatctgccctcttttcaccgattctgcaacagaa
cgtgaggtgagtgctgtacagtcggaacatgagaaggacattagtaatgatactagacgt
ctttttcagctagagcgaagcttgtcaaaaagtggtcatgattatacgaaattcctctcc
ggtaatcgatactctttatttgagtccagttgtgcacaatcggtgaatacacgcgaaaag
ttgttgcaattctattcaacatggtattcgtcaaatgtgatgggactagttattcttgga
agagaatccataaatgacctagagaaacttgcagaagataagttttcggaagttattgat
cgtaatgttgtgcaacaatcatggaacgatactccatggcctgatatatgtctcaagaaa
atggtatatgtcgtcccactgaatgacgtccatcaaatgaatataatgtggcctattcct
gactatattccagactatacagctcaagcccctagttatgtgactcatttacttggtcat
gaaagccgcggaagtttactgagtttattcaaaaatgcaggctgggctaatcgattagca
tgcggagttagtagaccagcagctgggatctgttctctgattttgtctattgatttaact
ttaaaaggacttgataaaactgatgaaattatgacaaatgtatatcaatacattaacatg
cttcgctctgatgaaccacaaaagtggatatttgatgaagaacaggctttatgtcaatta
aactttcgatttaaagacaaagaaccaccttatgaatatgtgactggattagccggtaat
ctattgctttatgacatgcaagatgttctaaccggttctttcttggcaactgtttataat
ccagatttaattaaaaaaatcataagttgtttaacgcctgataatagccggtatgtgata
tttgtcttttataatgtttttgatttgcagtaccgtgttaatatttgtaggtttgaatat
atggtttctcatgttttgccatctgacaatcaaagtgcatggcgaaacagttcttctaat
ccagaattgagattccccgaaccaaattcattcattgctactgaattcgatctggtgcaa
aacaaatgccccacgaatgttgaaatgccggaattattaatcgaaacagagatgtctcgt
atttggtactttcaagatacagaattcaatcttcccaaaggttttatcacatttcatatt
gtcagtccatttgcatttttcgatccttttcatacatcacttggtttaatttacgcaaac
ttatttgaggatcatattaacgaactgacatattcctctatgcttgctggaatgactgtt
tatgtgaaacacactgttgaaggtatcaagctatcatttttaggatattcgcataaattg
aaaagttttgtcaaagaaatcgtaacaaaatttgtgaattattatcaaccagttactgac
cgtttcgaatgtattcgtgagaatatgtctcgagagttttccaatttctcaatgaaacca
gcttatcaacagtccggtgcatatttaacaagtcttatttcagatcattcttggatcagt
gatgattttgtgcgtgcttttaaagaggttacgtacgaaaggttaattaatttcattatg
gaatttcatgaacgcatttttattgaaggccttatctatggaaatatcactgaagaggat
gcaataagttatcacgaaatggttcgggacttgttggtacaaaagatgaattctaaacca
cttttactgtctcacatcttaacctctcgagaagtaataattcctgaagattccagtttt
ctttatcaacgatatatttctggtcaaccggcttctgcgatttactattatcttcaatgt
ggtgaacaatctacgtttaatgatacattgcttaatttgttttgtcagattgtcagcgag
cctgttttcaataaattacgtaccgaacaacaattgggttatgttgtacaggctggactt
cgacgatccaacaaactacaaggttttcgtattttagtgcaatcatcttatcatcctaat
aaaattgataaatgtatcgaagaatttctacttactgtaaataaactgttagaagatatg
tctgacgaagaatttaatgttcatgtgcgatccctcatgacacatttactggaaaaaccg
aaaggtatgcaagatcgatttgggcgtttatggtctgaaattgcttgtcgacattataat
ttcaaacgacatttacatgaagccggtgtcctgaaatcgctgaaaaagaatgatgttatc
gatttctttagagtacgtgtaactcaacaagacacttttcgttcctacttttaa

DBGET integrated database retrieval system