KEGG   Schistosoma haematobium: MS3_00756Help
Entry
MS3_00756         CDS       T05004                                 

Definition
(RefSeq) Sodium/potassium-transporting ATPase subunit alpha
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shx04147]
    MS3_00756
Enzymes [BR:shx01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     MS3_00756
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MS3_00756
  Exosomal proteins of other body fluids (saliva and urine)
   MS3_00756
  Exosomal proteins of colorectal cancer cells
   MS3_00756
  Exosomal proteins of bladder cancer cells
   MS3_00756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase_N Hydrolase Cation_ATPase HAD
Motif
Other DBs
NCBI-GeneID: 24588552
NCBI-ProteinID: XP_012792391
UniProt: A0A095AFH4
Position
Unknown
AA seq 864 aa AA seqDB search
MNNVKTICFLKIRKVCRKVTCKKKPENNKLKDGLDDLKQELDMDEHKIPLEELYARLNTD
PENGLKSEEVKIRLERDGPNALTPPKTTPEWVKFCKTLFGGFSMLLWIGAILCFIAYGIQ
RSAEDEDVKDNVDNSALTGESEPQSRTTEFSNENPLETRNLAFFSTNAVDGTCRGIVIST
GDRTVMGRIANLASGLELGETPIHKEINHFIHLITAVAMVLGVTFFIIAFILGYRWLEAV
IFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTL
TQNRMTVAHMWFDNKIFDADTTENQTGARFNKSSPTWTALARIAMLCNRAEFKTGEENKP
VLKRECNGDASETAILKCTELCVGKLSIHETDDKDERYLLVMKGAPERIIDRCSTILLNG
KEKPLNDEMRERFNKSYMKLGGMGERLIALFRNFKFNEEEPNFPVSGLRFVGLMSMIDPP
RAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISKGSKTVEDIAAEKGIPVEQV
NPREAVACVVHGSDLREMTPAQIDDILVNHPEIVFARTSPQQKLIIVEGCQRQGAIVAVT
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LVYIGFGLPLPLGTITILCIDLGTDMIPAISLAYEEAESDIMKRMPRDPLHDRLVNERLI
AMAYGQIGMIQALGGFFVYFVIMAENGFWPSRLVGIRKEWDSRAVDALSDSYGQEWTYKQ
RKRLESTCQTAFFASIVIVQWADLIICKTRRNSVIQQGMWNKYLNFALFFETALAIFLSY
CPGLDKGLRMMPLSLTLSSLDANT
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgttaaaacaatttgttttttgaagatacgaaaagtctgccgcaaggttact
tgcaaaaagaagcccgaaaacaataaactgaaagatggtttggatgatcttaaacaagaa
ttggatatggatgagcacaaaataccgcttgaagagttgtatgctcgacttaacaccgac
cctgaaaatggattgaaatctgaagaagttaaaattcgattagaacgtgatggacctaac
gcactgacacctccaaaaacgacaccagaatgggtgaaattttgtaagacactgtttggt
ggattttcaatgctactttggatcggtgccattctctgctttattgcatacggtattcag
agaagtgctgaagatgaagatgtaaaggataatgtagataattcagcattgactggtgaa
tcagagcctcaatcacgtacaacagagttttctaatgaaaatccattagaaacaagaaat
ttagcctttttctcaactaacgctgttgatggtacatgccgtggtattgttatcagtaca
ggcgatcgtactgttatgggtcgtattgcaaatttagcatctggtttagaacttggcgaa
actccaatacataaagaaataaatcattttattcatttaattacagctgttgcaatggtt
cttggtgtaacattctttattattgcttttatattgggttatcgttggcttgaagctgtt
atcttcttaattggtattattgtagctaatgttccagaaggtctattagccacggttaca
gtatgtttaacattaaccgctaaacgtatggctagtaaaaattgtttagtgaaaaattta
gaagctgttgaaacacttggatcaacaagtaccatttgttcagataaaactggtacatta
acacaaaatcgtatgactgtagcacatatgtggtttgacaataaaatatttgatgctgat
actacagagaatcaaacaggtgcacgttttaataaaagttcaccaacatggacagcttta
gcacgtattgcaatgttatgtaatcgtgctgaatttaaaactggtgaagaaaataaacca
gttttaaaacgtgaatgtaatggtgatgcttcagagacagctatattaaaatgtactgaa
ttatgtgttggtaaattgtcaattcatgaaactgacgacaaggatgaacgttacttgctg
gttatgaaaggtgcacctgaacgtattattgaccgttgtagtactattctacttaatggt
aaagaaaaacctctaaatgatgaaatgcgtgaacgattcaataaatcctacatgaaatta
ggtggaatgggtgaacgacttatcgctttatttaggaatttcaaattcaatgaagaagaa
ccaaattttccagttagtggattacgttttgttggtctaatgtctatgatcgatccacct
cgtgcagctgtaccagacgcagttgcaaaatgtcgatccgccgggattaaagtgatcatg
gtcactggtgatcatccaatcacagcgaaagctattgctaaaggtgtggggataatttcg
aaaggttcaaaaactgtcgaggatattgcagctgaaaaaggcatacctgttgaacaagtg
aatccacgtgaagctgttgcttgtgttgtacatggttctgatttacgtgaaatgactcca
gcacaaattgatgatatattagttaatcatccagaaattgtatttgcacgtactagtcca
caacaaaaattaattatagtagaaggttgtcaacgtcaaggtgcaattgttgctgtaacc
ggtgttgcaatgggtatagccggtagtgatgtaagtaaacaagcagcggatatgatttta
ttagatgataattttgcttcgattgttacaggagttgaagaaggtcgtcttatatttgat
aatttgaaaaaatccattgcatatacattaacatcgaatataccagagattacaccattt
ctagtgtatattggatttggtttaccattaccattaggtacaattacaattctatgtatt
gatttaggtactgatatgattccagcaatttcattagcttatgaagaagctgaatcagat
attatgaaacgtatgccacgtgatccattacatgatcgtttagtaaatgaacgtttaatt
gctatggcttatggtcaaattggaatgatacaagcacttggtggtttctttgtttatttt
gttattatggctgaaaatggtttttggccaagtagattagttggtatacgtaaagaatgg
gattcacgagctgtagacgcattaagtgattcatatggtcaagaatggacttataaacaa
cgtaaacgtttagagtccacatgtcaaactgcattttttgcatcaattgtcatagtacaa
tgggctgatttaattatttgtaaaacacgtcgtaattcagtaatacaacaaggaatgtgg
aataaatatttaaattttgcattattctttgaaactgcattagcaatcttcttatcctat
tgtcctggtttagataaaggtctacgtatgatgcctttaagtttgacattatcatcttta
gatgcgaacacatga

DBGET integrated database retrieval system