KEGG   Schistosoma haematobium: MS3_01031Help
Entry
MS3_01031         CDS       T05004                                 

Definition
(RefSeq) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
shx  Schistosoma haematobium
Pathway
shx00350  Tyrosine metabolism
shx00360  Phenylalanine metabolism
shx00380  Tryptophan metabolism
shx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MS3_01031
   00360 Phenylalanine metabolism
    MS3_01031
   00380 Tryptophan metabolism
    MS3_01031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shx04147]
    MS3_01031
Enzymes [BR:shx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MS3_01031
    4.1.1.105  L-tryptophan decarboxylase
     MS3_01031
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS3_01031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Aminotran_1_2 Mak10 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 24588813
NCBI-ProteinID: XP_012792657
UniProt: A0A095AG94
Position
Unknown
AA seq 357 aa AA seqDB search
MVHALGLPDKFLSSSSVNDPLHKGGGVIEVSASLACATVALGIRDRVMKTYVKNTSQSTK
IIDENKTGSMVDRMVAYTSDQAHSSVIRAFHLAMLKCHMIQTRKMEKKLIFDSKDLKEAI
ENDINKGFIPVMCVATMGTTSTCEFENLYEIGNICKKFNIWFHVDAAYAGSALLCPEFRY
LGKGIELANSININAHKLLLVNFDCSLLWLSDHTVISTAFQVDPLYLQHTFEGMPEYRHF
DLAKKFEQLLTTDGRFEIVNDVQFGLVCFRLKNNNELTKKLHENLLNKGEVYLVLSSYHE
NAGQELGQMNTTISYQTTTTTVFLRFVSIHGTTMKDIDYAYQKIASCATEILDQFNE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggttcatgcattaggattaccggataaatttttgtcatctagtagtgtgaatgatcca
ttacataaaggtggtggagttattgaagtaagtgcaagtttggcttgcgcaacagtagct
ctgggtatacgcgatcgagtgatgaaaacgtacgtaaaaaacactagtcaatctacaaaa
atcatagatgagaataaaactggatcaatggtcgatcgtatggtagcgtatacatcagat
caggcacacagctctgtcattcgggcatttcatctggctatgttgaaatgtcacatgatt
caaacaaggaagatggagaaaaaattgatttttgattcaaaggatttaaaagaagcaatt
gaaaacgatataaacaaaggttttattccagttatgtgtgtagcaacaatgggtacaaca
tcgacatgtgaatttgaaaatctttatgaaatcggtaacatttgtaagaaattcaatatt
tggtttcatgtcgatgcagcatatgcgggaagtgcattactttgtcctgaatttcgttat
cttggcaagggtatcgaattagctaactcaattaatatcaatgctcataaattattactt
gtaaactttgactgttcattactttggctaagtgatcacactgttatatcgactgcattc
caagtggatccactttatttgcagcatacttttgaaggaatgccagagtatcgtcatttt
gatttagctaaaaagtttgaacaactattgacaacggatggtcgttttgaaattgtcaac
gatgtacaattcggtctggtgtgttttcgactaaagaataataatgaattaacaaagaaa
ttgcatgaaaatttattaaataaaggtgaagtatatcttgttttaagttcatatcatgag
aacgcaggtcaagaacttggtcaaatgaatacaactatatcatatcaaacaacaacaacg
actgtatttcttcgatttgtttcaatacacggtacaacaatgaaagatattgattatgct
tatcagaaaattgcttcatgtgctacagaaattcttgatcaattcaatgaatga

DBGET integrated database retrieval system