KEGG   Schistosoma haematobium: MS3_02954Help
Entry
MS3_02954         CDS       T05004                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
shx  Schistosoma haematobium
Pathway
shx00520  Amino sugar and nucleotide sugar metabolism
shx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MS3_02954
Enzymes [BR:shx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     MS3_02954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 24590596
NCBI-ProteinID: XP_012794498
UniProt: A0A095BZV7
Position
Unknown
AA seq 296 aa AA seqDB search
MQDGHEVIALDNFFTGKRHNIEHWIGHSNFELLHHDVTNPIYVEVDEIYHLASPASPQHY
MHNPIRTIKANTLGTLNMLGLARRTNAKFLFASTSEIYGDPEVHPQPESYWGNVNPVGPR
ACYDESKRLGETMTYAYFRHLNLPVRVARIFNTYGPRMQVNDGRVVTNFIAQALNNESIT
VYGLGEQTRSFQYISDLVNGLVALMESNYTMPVNLGNPVEFTVNELAIMVKNFTDSKSDI
IYQPLPIDDPQRRQPDISTAIKQLNWKPTVTLQEGLSKTIIYFKDILKPSSECDVH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatggtcatgaggttatagctcttgacaattttttcacaggaaaacgacataat
atcgaacattggattggacatagtaattttgaacttttacatcatgatgttaccaatcct
atatatgtggaagtggatgaaatttaccatttagcttcaccagcgtcacctcaacattat
atgcataatcctatacgtactattaaagcaaacacattgggtactttaaatatgttagga
ttagctcgtcgtacaaatgccaaatttttattcgcttctacttcagaaatttacggcgat
cctgaagttcaccctcaacctgaatcctactggggtaatgtaaatccagttggtccaaga
gcttgttatgatgaaagtaaacgacttggtgaaacaatgacttatgcttattttagacat
cttaatcttcctgttagagttgctcgtatattcaatacatatggaccaagaatgcaagtt
aatgatggtcgagtggtaactaatttcattgcacaagcattaaacaatgaatcgattacg
gtatatgggttaggagaacaaactagatcttttcagtatatcagcgatcttgtgaatggt
cttgtagctttaatggaatccaattatacaatgcctgttaatttgggaaatcctgtcgag
tttacagtgaatgaattagcaatcatggtcaagaattttacagacagcaaaagtgatata
atttatcaaccgttaccaattgatgatcctcagcgaagacaacctgatataagtacagct
ataaaacagttaaattggaaaccgacagtaactttacaagaaggactaagtaaaactata
atttatttcaaagatattttaaaaccatcatctgaatgtgacgtgcattag

DBGET integrated database retrieval system