KEGG   Schistosoma haematobium: MS3_03865Help
Entry
MS3_03865         CDS       T05004                                 

Definition
(RefSeq) Nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
shx  Schistosoma haematobium
Pathway
shx03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:shx00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    MS3_03865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:shx03009]
    MS3_03865
Ribosome biogenesis [BR:shx03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    MS3_03865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop
Motif
Other DBs
NCBI-GeneID: 24591446
NCBI-ProteinID: XP_012795376
UniProt: A0A095AN11
Position
Unknown
AA seq 315 aa AA seqDB search
MRGIRTHIDNLLPVVEDSHMMRMRLGLAHSLDRYKLKCNPDKIDTMIVQAVGLMDELDKE
INNYIMRAKEMYGWHFPELSKIVLDNVTYVKVVKRIGHRTNSSVDLSDLVPDEIASQIRE
ASIVSLGTEVIDEDITMINELCDQVLEASASRTQLHDYLIKRMVAVAPNLTALVGELLGA
RLIARAGTLVNLAKHPASTVQILGAEKALFRALKTRHNTPKYGLLYHATLVTQSDNQFKG
KMSRMLAAKASLSARLDALGEEGVDTEMGIRARAYLEKRLRQLEAGTFNPRLSAIKRGLK
SEDGQPKSKKMKVDE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggaatccggacacatatcgataacctccttcctgttgttgaagatagtcacatg
atgaggatgcgtttgggtttggctcacagtcttgatagatataaactgaaatgtaaccca
gacaaaattgataccatgatagttcaggcagtcggcctcatggacgagctagacaaagaa
ataaacaactatattatgcgtgctaaagaaatgtacgggtggcattttcctgaattgtcg
aagatagttttggataatgtaacatacgtcaaagtagtcaaacgaatcggtcacaggaca
aattcaagtgttgacttatcagacctcgtaccggatgaaatagctagtcaaataagagaa
gcttctatcgtctccttaggaacagaagtaatcgatgaagacattactatgatcaacgaa
ctgtgcgatcaggtacttgaagcttctgcctcccgtactcagctccacgattatcttatc
aagcggatggtggcagtagctccaaatttgacagctctcgtcggggaacttttgggtgca
agactcatagctcgggcaggaacacttgttaacctagctaaacatcctgcttcaacagta
cagatactaggcgctgagaaggcattattccgagcattaaaaacacgacataacactcca
aaatacggtctgttgtatcatgccacattagtaacacaatcagacaatcaattcaagggt
aaaatgtcacgaatgttagctgcaaaagcatcattatcagcgcgtcttgacgctcttggt
gaagagggtgttgacacagaaatggggatacgagcaagagcatacttggaaaagagactt
cgacagttggaagctgggacttttaacccgagattatcggcgattaagcggggattaaag
tcagaggacggtcaaccgaaatcgaagaagatgaaggtggatgagtga

DBGET integrated database retrieval system