KEGG   Schistosoma haematobium: MS3_05076Help
Entry
MS3_05076         CDS       T05004                                 

Definition
(RefSeq) Monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shx01002]
    MS3_05076
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shx04147]
    MS3_05076
Enzymes [BR:shx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     MS3_05076
Peptidases [BR:shx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   MS3_05076
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   MS3_05076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 DLH
Motif
Other DBs
NCBI-GeneID: 24592554
NCBI-ProteinID: XP_012796527
UniProt: A0A094ZPZ7
Position
Unknown
AA seq 349 aa AA seqDB search
MILLWVSAFLVHLALILYIALPLIVEKFPAFCRRLVFKTHSGPSFGSRVYTHFESVDIPS
GHGHNFYIASLDDKALLGVWHILPSNNEEISATDSRSYEEIMNSLPNDLPVFIYFHGNSK
SRAIPWRVNIYKLLSSLGYHVFCFDYRGYGDSTGSLTGENDCLLDSLTVFQFVCKRFPSA
PIFFWGHSLGTGVVGCLMDHLNKEHDSLPNIRLPKGIILDAPFTCLTDVIHHRIFMKPYQ
LMPTLQERFVSAMNKVKLSFNTQSNLINCPIPIVILHAEDDAVVPFTLGKKLAEILSTNG
TSVFFKPYEGKLGYRHNFIHTAPDLPDIITSFVQSTLSGSLNALEDLII
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattctgttatgggtgtcagcatttttagtgcacttggctctgatcttgtacatagca
ttaccgttgattgtagagaagtttcctgctttttgtcggcgactagtttttaaaacacac
agtggacctagctttggttcccgagtttatacacactttgaatctgtggacatccctagt
gggcatggccacaatttctacatcgcttctctagatgacaaagctctgttaggagtatgg
catattcttccatcgaataatgaagaaattagtgctaccgattcacggagttatgaagaa
ataatgaattcattgcctaatgatttgcctgtatttatttatttccatggcaattctaaa
tcaagagctattccttggagggtaaacatttataaactattgtcatctcttggctatcac
gttttttgtttcgattacagaggttatggcgattcaactgggtcattaactggagaaaat
gactgtctactggatagtttaacagtttttcaatttgtttgtaaacggtttccttcagcg
ccgattttcttttggggtcattcacttggtactggggttgtcggttgtcttatggatcat
ttaaataaagagcatgattctttaccaaatattcgtcttccaaaaggtattattcttgat
gccccatttacatgcttaactgatgtgatacatcacagaatattcatgaagccttatcaa
ttaatgccaactttacaagaacgatttgtatcggctatgaacaaagtaaaattgtcattt
aatacacagtctaacctaataaattgtcccattccgatagtcatattacacgctgaagat
gatgctgttgtgccattcactttaggaaaaaagcttgctgaaattctttcaactaatggt
acttcagtattcttcaagccgtacgaaggcaaactcggttaccgacataattttattcac
acagcaccagatcttccggatattattacatcatttgttcaatccacattgtctggaagt
ttaaatgcattagaagatttaatcatttga

DBGET integrated database retrieval system