KEGG   Schistosoma haematobium: MS3_05089Help
Entry
MS3_05089         CDS       T05004                                 

Definition
(RefSeq) Multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
shx  Schistosoma haematobium
Pathway
shx00010  Glycolysis / Gluconeogenesis
shx00562  Inositol phosphate metabolism
shx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS3_05089
   00562 Inositol phosphate metabolism
    MS3_05089
Enzymes [BR:shx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     MS3_05089
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     MS3_05089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 CLTH
Motif
Other DBs
NCBI-GeneID: 24592566
NCBI-ProteinID: XP_012796535
UniProt: A0A095C4N9
Position
Unknown
AA seq 478 aa AA seqDB search
MGALFSAFCAIATFLLCIFNREPETFFSGLSSKTAYRFCGLKSYEDKVSAQFKRCSLVHV
NVLLRHGTRAPDSKSIKSFTDLHERLKESYNNGSPIPYKLLTHPIPFKNAAAKELLPRGF
QEHDGLGRRFFNLMRQHFNFTIENVDFYSSSIDRCIASGRAFYNEINNNDHYKKKNITIN
NYLLRFFADCKNYIENIEKNKSAIREYYQFLNSNYIINSYENFIKRFNLKRENYTFDDLK
IIFLACAYEVAAMDDYDDLSPWCSLLTPYDYPVWEYLADLKHYWRKSYGYELNYEQSCPL
LGEIIQQIYNVAINFQKNNYSQNNPTLHRGSFWFGHAETILPIVAALGIFNNSIGHSTLH
KLTADSFDERLRMIYDTDVPSPTMFRTSYIAPFAGNVAFLLYYCPDLEDSDNDLDKFRVK
VLINEKTISWPLASSIQPPTLDHPGETNASLTTILQYFNGCMPNNYDNNKVCSLHKTF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgggggccctgttttcagccttctgtgcaattgctacttttttactttgtattttcaac
cgtgaaccagaaacgtttttttcaggcttatcatcaaaaacagcatatcgcttttgtggt
ttgaaatcatatgaagataaagtgtctgctcaatttaaaagatgctccttggtgcatgtt
aatgtattactcagacatggaactagagcaccagattccaaatcaatcaaatctttcaca
gatttacacgaacgtcttaaagaaagttataacaatggatcaccaattccttacaaactt
ctaacacatccaataccttttaaaaatgctgctgcaaaagaacttttacctagaggattt
caagaacatgatggtttaggaagacgtttttttaatctcatgcgacaacatttcaatttt
acaattgaaaatgttgatttctactcgagttccattgatcgttgtattgcaagtgggaga
gcattttataacgaaatcaataataatgatcattacaaaaagaagaatataacaattaat
aattatttattaagattttttgctgattgtaaaaattatattgaaaatattgaaaagaat
aaatcagctattcgagaatattatcaatttcttaattcaaattatattattaattcttat
gaaaattttattaaacgatttaatttaaaacgtgaaaattatacatttgatgatttaaaa
ataatatttttggcttgtgcgtatgaagttgctgcaatggatgattatgacgatctatca
ccttggtgtagtctattaacaccttatgattatccagtatgggagtatttagcagattta
aagcattattggcgtaaatcgtacggttatgaattgaattatgaacaatcgtgtccttta
cttggtgaaataatacaacaaatttataatgtagctataaattttcagaaaaacaactat
agtcaaaataatccaacattacatcgtggaagtttttggttcgggcatgcagaaactatt
ctacctattgtcgctgctttaggtatattcaataactcgattggtcattcaactttacac
aagttaacagcagatagctttgatgaaagattaagaatgatctatgatacagatgttcca
tcgcctacaatgtttcgcacaagttatatagcaccatttgctggcaatgtggcttttcta
ttatattactgtcctgatttagaagattctgataatgatctggataaatttcgtgtcaaa
gtattgatcaatgagaaaacaatttcttggccattagctagttcaatacaaccgcctaca
ttagatcatccaggtgaaacaaatgcttctctaacaactatattacaatatttcaacggt
tgtatgcctaataattatgataataataaagtttgttcacttcacaagacgttttag

DBGET integrated database retrieval system