KEGG   Schistosoma haematobium: MS3_05380Help
Entry
MS3_05380         CDS       T05004                                 

Definition
(RefSeq) Calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shx01001]
    MS3_05380
Enzymes [BR:shx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     MS3_05380
Protein kinases [BR:shx01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   MS3_05380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 24592840
NCBI-ProteinID: XP_012796818
UniProt: A0A095ARP0
Position
Unknown
AA seq 346 aa AA seqDB search
LRHPNIVQLFDVLEDAECYYLVMELVTGGELFDRIVQKGSYTERDASALIRQVLLATEYM
HSQGVVHRDLKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLSV
NEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDS
AKDFISNLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAY
NATAVLHLLRRLQLNKSNSTAEKSTNSTDSLSTFTFDEDKLAEIQCKQLKSNSIDKQDKL
PPKLQTSCSSPSSLSSPTRPPEIKPFSFNNITDEIKNIEKNDNNTT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ctcagacacccaaatatagttcagttgtttgatgtcttagaagatgcggagtgttactac
cttgttatggaactggttactggaggggaattattcgatcgtattgttcagaaaggtagt
tatactgaacgtgatgcaagtgcccttattcgacaagttctgttagctactgaatatatg
catagtcaaggagttgtacatcgagatttgaaaccggaaaatctactctactttagtcca
gctgatgatagtaaaataatggtgagtgattttggcttgtcaaaaatagaaaacaatgag
tccatcatggctacagcctgtggtacaccaggttatgttgctcctgaagttcttagtgtt
aatgaaggcagttccggttatggcaaagaagtagactgttgggctattggtgtgattgca
tacattttattatgtggatatccaccattctatgatgaaaatgatcatgaattgtttcgt
caaatacgaatggcagaatatgaatttgattcaccgtattgggataatatatctgactca
gccaaagattttattagtaatctactccaaaaagatccaaaaaaacgctatagttgtgta
caagccttagaacatccatggatagctagtaatacagcacttgatagggatctttatcct
tttgtcagtgaacagatacgtaaaaatttcttagcagtaaaacgatggaaaaaagcttat
aatgcaacagcagtacttcatttattacgtcgtcttcaattaaataaaagtaattcaaca
gcggaaaaatcaactaattccactgattctttatctacgttcacatttgatgaagataaa
ttagcagaaatacaatgtaaacaattaaaatcaaattctattgataaacaagataaatta
ccacctaaattacaaacatcatgttcatcaccatcatcattatcttcacctactcgtcct
cctgaaattaaaccattttcattcaacaatataactgatgaaattaaaaatattgagaaa
aatgataacaatacaacttaa

DBGET integrated database retrieval system