KEGG   Schistosoma haematobium: MS3_06219Help
Entry
MS3_06219         CDS       T05004                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shx01001]
    MS3_06219
Enzymes [BR:shx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MS3_06219
Protein kinases [BR:shx01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   MS3_06219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 Ribosomal_L18A Marek_A Choline_kinase
Motif
Other DBs
NCBI-GeneID: 24593624
NCBI-ProteinID: XP_012797625
UniProt: A0A095C712
Position
Unknown
AA seq 356 aa AA seqDB search
MLSSRPFVPKTSTITSEYTITNNVLGLGITGKVMQCVHNETGVQYALKILEDNQKSRREA
EIHWRVSDCPHIVKVVDVFENTNQNTKKNYLLIVMEYMRGGELFNKIKKYENFTESEAAK
IVYQISSAIAYLHERNIAHRDLKPENLLYTSNENGAILKLTDFGFAKEVVTKKSLQTPCY
TPYYVPPEILNFERYDKSCDIWSLGIITYILLSGCPPFFSQNGQPISPGMKSKIRAGKYD
FPDAQWKYVSKSAKDLIKSLLLTEPDRRPTIREVMNNHWVAQYNDVPNTPLGTSMFFTTK
AWDQFREMFRESLQTKRKEHSNVPTLMTLDASKNPLLIKRKINQKSNPENNSHKVL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgtctagaccatttgttccgaaaacgtctactataacatcagaatatacgatt
acaaataatgtgcttggcttaggaatcacaggaaaggtgatgcaatgtgttcataacgag
acaggagtccagtatgctttaaagatacttgaggacaatcaaaagtcaagaagagaggct
gaaattcattggagagtctcagactgtcctcatatcgtgaaggtcgtagacgtgtttgaa
aacacaaaccagaacactaaaaagaattaccttttgatagtaatggaatatatgaggggt
ggtgaactatttaataaaattaaaaaatatgaaaattttacggaaagcgaagctgcaaaa
atagtgtatcaaatatcctctgcaattgcttatcttcatgaaagaaatatagcacaccgt
gaccttaaaccggaaaatttgctttacacgtctaacgagaatggtgccatcctaaaactt
acggactttgggtttgcgaaagaagtcgtcactaaaaagtctcttcaaacaccatgttac
actccttattatgtcccaccagagatccttaattttgaacgatatgacaagtcctgtgac
atctggtccctagggataataacctatattttgctctcaggttgtccgccattttttagt
cagaatggccaacccatatctcctggtatgaaatcaaagattcgagctggaaagtacgac
ttccccgatgcacaatggaagtacgtttcaaaaagtgctaaagatctaatcaaaagccta
ttactcacagagccagatcgtagacctacaatcagagaagtgatgaacaaccattgggtg
gctcagtataatgatgtgcctaacacacctcttggaactagtatgtttttcactacaaaa
gcatgggatcaatttcgagagatgtttcgtgaaagtcttcagacaaagcgtaaagaacac
tccaatgtccctactttgatgactttagatgcttccaaaaatcccttattaattaaacgt
aaaatcaatcaaaaatctaatcctgaaaataattctcataaagtgctataa

DBGET integrated database retrieval system