KEGG   Schistosoma haematobium: MS3_06692Help
Entry
MS3_06692         CDS       T05004                                 

Definition
(RefSeq) Pseudouridine-5'-monophosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shx01009]
    MS3_06692
Enzymes [BR:shx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     MS3_06692
Protein phosphatases and associated proteins [BR:shx01009]
 HAD phosphatases
  Other HAD phosphatases
   MS3_06692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 24594062
NCBI-ProteinID: XP_012798069
UniProt: A0A095C820
Position
Unknown
AA seq 238 aa AA seqDB search
MIEITHVIFDVDGLILDTESIYTEFTSNFLSEYNLQFDYNIKKLMMGRKPHEAGEILVKH
YNLPLSASEFIQRQSKYITPKRWESVQCLPGAEKLILHLASHNIPMALATGCCSYELDQK
MRSHQVIMTKVSHSVCSGDDPTVKHGKPMPDIFLTTASRFKIPPDSSDSVLVFEDSPNGV
EAALSAGMHVVWIPDPREPPGNFPKSTSSIDISRVTRLNCLSDFKPEQFGLPRFENDS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgattgagattactcacgttatatttgacgtcgatggtcttattttggatacagaatcc
atatacactgagttcacatcaaattttcttagtgaatacaatttacagttcgactacaac
ataaaaaaactaatgatgggaagaaaacctcatgaagccggtgaaatacttgtaaagcac
tataatttgccactaagtgctagtgaatttatccaaaggcagtcaaaatacattactcca
aaaagatgggaaagtgttcagtgtttaccaggtgcagagaaacttattttgcatcttgct
tctcataatattcctatggccctagctactggttgttgcagttatgaacttgatcagaaa
atgagaagtcatcaagttataatgaccaaagtatctcattctgtttgctctggtgacgat
cctactgttaagcatggtaaacctatgccggatatatttctaactactgctagcagattt
aaaattcctccagattcctctgatagtgttttagtgtttgaagactctccaaatggtgtt
gaagccgctctatcagctggaatgcacgttgtatggattcctgatccacgagaaccacct
ggaaattttccgaaatcaacttcatccattgacatatcacgtgtcactagattaaattgt
ctgtctgattttaaacctgaacagtttggtcttccaaggttcgaaaacgactcttga

DBGET integrated database retrieval system