KEGG   Schistosoma haematobium: MS3_07558Help
Entry
MS3_07558         CDS       T05004                                 

Definition
(RefSeq) Myotubularin-related protein 3
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
shx  Schistosoma haematobium
Pathway
shx00562  Inositol phosphate metabolism
shx01100  Metabolic pathways
shx04070  Phosphatidylinositol signaling system
shx04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MS3_07558
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MS3_07558
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    MS3_07558
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shx01009]
    MS3_07558
Enzymes [BR:shx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     MS3_07558
    3.1.3.64  phosphatidylinositol-3-phosphatase
     MS3_07558
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     MS3_07558
Protein phosphatases and associated proteins [BR:shx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    MS3_07558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 24594866
NCBI-ProteinID: XP_012798901
UniProt: A0A095AWV2
Position
Unknown
AA seq 1534 aa AA seqDB search
MNVISMHFLPGEEPVNTKSIADGILTLTNYRLIFSTKRPQSSWSIPTTLVWKAEVFEMIH
IKIITKIGISVTWSFVDEIACDAGYAHITSLIDIPKDIDSLFACKFRSSLEANIPNHPFL
LSACELLQINDVDRTLDTALVCFEFRRMNFDKTWKITDINNEFKICSTYPRHHIVPRSIS
DNDIINMASFRSHNRFLTVVWRSQVTGAVLLRCAQPCVGLMCSRNEYDEKFLRTVLACCP
KKPVSDPKKDTHRLMIVDARSRSSAQFNRIRGGGFEYPEYYDQAEVVFMDLPNLHTVRSN
FESLTNLFAGKCPNWFSSLEKSSWLNNIGQLLKTATEIAIALEENARPVMVHCTDGWDRT
PQISSLAQLLADPFYRTIQGFNILVEREWLQFGHKFSDRSGYASPSLNINEQSPIFLQWL
DCVHQIRNQFPHCFEFNESFLLKLGLHICSNLFGTFLCNSEKERQKASVASRTCSLWGLL
SSKYNWTIVNYFYEPEAEHLLQPDCQVRSLSLWSAFYGIALSTSKVNPTLDIPQDVIEAT
PNNTHSVTNSTISSTKHKSLPSIDPAPHKTNSTSKINYEKLSQPTTNLLGDDHPSDSIKI
TVPNLKIDTSEEVNSDGNLFIKGYASSRNSYRRSLDDINNYVDSRSNKQQSREFSLSNRV
SPTIMKSSSQCFFEDNVCNEKNSPGPAILRLSSLSDDTGICSGLSKSYIRSLSSLINGSY
PFPKHSDKCISPESGPAQLTVSSCTYVNQFQQQECVLSPDENVDVFASDEQLEQNDFSFT
NHNNNLDNMNSCSNNLLSSGRLYYSQFSQPIQNCQFYGKCSPLSISPRQFEFNDCDDSNH
NHSVNPESNSKIPFNFNLDGVQGDNFTYNSPRWSVTTRGSNTSLYVLSDVKQSSTELLKP
VSINSSQPMDIKISRRFDIPNSLIPIGNGSVYPNEFTVHSLPENDEVLVNGAVSLTSDSD
DSPNECNDLNFSTPLGESLTGQLLSTNKTEISVFGHNGSEKFQDITGTISKLAWRNKYFR
LEYFPNMLSQSSSSVSCGSRNSSSSQMFDYSSNYNSKALKPGGSFDSKSHSVTVNPKISL
PEFTRITTNDDDVYNRPTSAPISPTSAVSYFPSTLHKNSTPLNREVHNPSIDQNISNGTN
ALEEIQKKPLSSTLMNTLSWFPDWDGLPMLVDRLTIHAHSQLCQERYNRKTQKQSMLALE
AKLKYAQLEVERLNSEARRLKQLLELTKTQTCKQDTNTLASSDDHLSSLSSSLSSYEQKF
TQNSHIKSQCKSKESSLLSSELFVSISKDKNISEEHNPSNVKSELTDAIESAPCKTTSFE
LIDTEDGQSVLLQPDCIAHQCTSCRIEFSALRPKHHCRNCGYIFCANCSDRRIVTTSQPS
EPVRVCRHCFFQLSRPTAKSSKQQLVEEYTPCIARHTIMKEDYNGGGLVKNFTNPDFLSY
MNNSIMLSTGSDSGCMPVSSFSNGAILRMSSSGVSHHFNDSFNSETTTSNATTTTAVNHR
LDSILTNNPPLSRCHSAGGARPTSSAASDGIAQA
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgatttcaatgcactttcttcctggagaggaacccgtaaacactaagtcgata
gctgacggaatcttgactcttacaaactatcgacttatattttcaacgaaaagaccacaa
agctcatggagtatacccactactttagtgtggaaagctgaagtatttgaaatgattcac
atcaaaatcataaccaaaattggtatatctgttacctggtcgtttgtcgatgaaattgct
tgtgatgctggatatgctcatattacgtcattaatagatataccaaaagatatagactct
ctgtttgcttgtaaattccgttcatctttagaagcgaacattccaaaccatccttttctc
ttaagtgcctgtgaattgttgcagattaatgatgtggacagaactttggatacagcgtta
gtatgttttgaatttcgtcgcatgaactttgataaaacatggaagataacagatattaac
aacgaattcaaaatttgctccacatacccgagacatcatattgtacctcgatctattagt
gataatgatataattaatatggctagtttccgaagtcacaatcgatttttaacagttgtc
tggcgttctcaggtaactggagctgtcttacttcgttgcgctcaaccttgtgtaggatta
atgtgttccagaaatgagtatgacgagaaattcctacgaactgttcttgcttgttgtcca
aaaaaacctgtttcagatcctaagaaagatactcatcgtttgatgattgtggatgctaga
agtcgtagcagtgcacaattcaatcgaatacgtggtggtggttttgaatatccagaatac
tatgatcaagcagaagttgtttttatggatttacctaatctacatactgttcgttcaaat
tttgaatccctaactaatctgttcgctggcaaatgtcctaattggttttcttcattagaa
aaatcatcatggttaaataatattggccagctattaaaaactgccacagaaattgctatc
gcattagaagaaaatgctcgtccggttatggttcattgcacagatggttgggatcgaaca
cctcaaataagttccttagcccaattgttagcagatccattttatcgaacaattcagggt
ttcaatattcttgttgaacgtgaatggctacaattcggtcacaagttttctgatcgaagt
ggatatgcttcaccctcattaaacataaatgagcaaagtccaatatttttacaatggctt
gattgcgtccatcaaattcgcaaccagtttcctcattgttttgaatttaatgaatcattt
ctgctaaaacttggcttacatatctgttcaaacttatttggtacatttctttgtaattct
gaaaaggaacgtcaaaaagcttcagtcgccagtcgaacttgctcattgtgggggttatta
tcctcaaaatataattggacaatcgtaaattacttttatgagccagaagcggagcatctt
cttcaaccggattgccaagttcgttcattaagtctttggagtgctttttatggtattgct
ttgtctacaagtaaagtaaatcctaccctagatattcctcaagatgtaattgaggcaaca
ccaaataatactcattcagttacaaattcaactatttcatctaccaaacataaatctctt
ccatccatcgatccagcacctcacaagactaattccacttcaaagatcaactacgaaaaa
ttgtctcaacctacaactaacctgttaggtgatgaccacccttctgattcaataaagata
acggtaccaaatttaaaaattgatacttctgaggaagtgaactcagatggaaatttgttt
atcaaaggatatgcttctagtcgaaactcatatcggcgttctcttgatgatattaataat
tacgtggattcgagatctaataaacaacaatctagagaattttctttgtcgaatcgtgtt
tctcccacaataatgaaatcatcaagtcaatgtttttttgaagataatgtatgcaatgag
aaaaatagtcctggaccagcaatacttcgtctttcttctctatctgatgatacaggtatt
tgttctggtttatcgaaatcatatatacgatctttatcatcgcttattaatggtagttat
ccttttcccaaacattcagataaatgtatatctcctgaatcaggtcctgcacagttaaca
gtgagttcatgtacgtatgttaatcaatttcaacaacaagaatgtgtactttctccagat
gaaaatgttgatgtttttgcttctgatgaacaattggaacagaacgatttctcttttact
aatcataataataatttagataatatgaatagctgtagtaataatctcctatcttcaggt
cgattatactattcacaattcagtcagcctattcaaaattgtcagttttatggaaaatgt
tcaccactgtctatttcaccaagacagttcgagttcaatgattgtgatgatagcaatcat
aatcatagtgtcaatcctgaatcaaatagcaaaataccttttaattttaatctcgatgga
gtacaaggtgataattttacttataatagtccacgatggtcagttactacacgaggaagt
aatacaagcctttatgtgttatcagatgtgaagcaatcttccactgaactattaaagcct
gtttcaattaattcatcacaacctatggacataaaaatatctcgtagatttgatattcct
aacagtttaataccgattggcaatggtagtgtatatcctaatgaatttacggtacatagt
ctaccggaaaatgacgaagtgcttgttaatggggcggtatctctcacatccgattcagat
gattctcccaatgaatgtaatgatttgaatttttcgacacctcttggagaatcattaact
ggtcaattgttatcgacgaataagactgaaatctctgtttttggtcataacggttccgaa
aaatttcaagatattactggtactatatcaaaacttgcttggcgaaacaaatacttccga
cttgaatattttccaaatatgctttctcagtcatcctcgtcagtttcttgtggcagcaga
aattcgtcttccagtcaaatgtttgactattctagcaattataatagtaaagccctgaag
ccaggtggatcattcgactcaaaaagtcattctgtaacggttaatcctaaaatttctttg
cctgaatttactcgcattacgactaatgatgatgatgtttacaatcgaccaacatcagcc
ccaatcagtccaacttcagctgtatcctattttccttctacactacataagaattctacc
cctttaaatagagaagtgcataatccttccatcgatcaaaacatatcaaatggtacaaat
gctttagaggaaattcaaaagaaaccattatcttctacattaatgaacacattgtcatgg
tttccagattgggatggtttacctatgctagtagatcgcctaacaatacatgctcactca
caattatgtcaagagcgttataatcgtaaaacacaaaagcaatctatgcttgcattagaa
gccaaattaaaatatgcacaactggaagttgaacggttgaattcagaggcgagaagactg
aaacaacttctcgagttgactaaaacccaaacatgtaaacaagacacaaatacacttgcc
tcatcagatgatcatttatcatcgctttcatcgtcattgtcatcgtatgaacagaagttt
acacaaaatagtcatattaagagtcagtgtaaatctaaagagtccagtttgttgagtagt
gaactgtttgtttctatttctaaagataaaaatatttcagaagaacacaatccatctaac
gttaagtctgagttaactgatgcaattgaatcagcaccatgtaagacaacttcatttgaa
ttaatagatacggaagatggtcagtctgttttactgcagcccgattgtattgctcaccaa
tgtacatcatgtcgtatcgaattttcggctttacgacctaaacaccattgtcgaaattgt
ggttatatattctgtgcaaattgttctgatcgtcgtattgttacaacaagtcaaccaagt
gaaccggttcgtgtatgccgtcattgtttctttcaactatctcgtcctacagcgaaatcg
tctaaacaacaattggttgaagaatacactccatgtattgcgcgacatacaataatgaag
gaggattataatggcggtggactggtaaaaaacttcactaatccagattttcttagttat
atgaacaattcaattatgctttccactggttctgatagtggttgtatgcctgtttcatct
ttctctaatggtgctatattaagaatgtcgtcaagcggtgtctcccatcacttcaatgat
tcttttaattcagagactactaccagtaatgctacaacaacaacagctgttaatcatcgt
ttagattcaatccttacaaataatccgcctctgtctagatgtcatagtgctggtggtgct
aggccaacctcctctgctgcgtcagatggcattgctcaggcttaa

DBGET integrated database retrieval system