KEGG   Schistosoma haematobium: MS3_09300Help
Entry
MS3_09300         CDS       T05004                                 

Definition
(RefSeq) Rho-associated protein kinase 2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
shx  Schistosoma haematobium
Pathway
shx04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:shx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    MS3_09300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shx01001]
    MS3_09300
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shx03036]
    MS3_09300
Enzymes [BR:shx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MS3_09300
Protein kinases [BR:shx01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   MS3_09300
Chromosome and associated proteins [BR:shx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    MS3_09300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_C MetOD2 Abi_HHR
Motif
Other DBs
NCBI-GeneID: 24596483
NCBI-ProteinID: XP_012800574
UniProt: A0A095A5E3
Position
Unknown
AA seq 684 aa AA seqDB search
MNKSCLDLSEFHTDQYIDIKERLVALEKHLSDPFSDCYVERLLDVVVACVTECTKTVKNV
KNENMLAFLQRFLNVAVCLQSYRRKPEDFSFISSLGHGAFGRVQLVREITTGRVCAMKVL
KKSRMLAQHTDYWAEKEIMSHGESPWIVQLYYAYQDLKNLYMVMEYVPGGNLVSWMDEVE
FMSEAACRFYAAETILALIDLHAMGFIHRDLKPDNLLLDAGGHLKLADFGTAIRVDPETS
LIHCDAAVGTPDYLSPEVLLSQGIGGGSYGFEVDWWALGVVIYEMLYGVTPFYSETLVNT
YANIMNHANSLKFPENVNVSDACLDFMKKLLCDRTQRLGSQAHCLSEVYNHPWFSIDWIQ
SQQTDGHLDSMDVSIADWTWSNIRASRAPFQPHLRSETDTSYFQPETDDEDDELMVDGEN
VVDKDSSNHGRNNGHDSELVDVTNNNNNGKCKDVARGGDFPESSNSDHKYSGRCSDSLLE
LPGSQLVFAGFSFSSSHPHHLALLNGLHSSPLRGSNLTASASSSDLLKNGDNINNNSNKL
GSVQLDKSMNHQLQENKCDNCKNSFLKSNGDVSSINNLLINNENENVMDSNISNHTKCES
QLAGLRIQLDDALTLSDTHLNEISSLTVQLEQANARCHELENKLSLQEINFKKIHEEMER
QLENVHAEAAKNRSYLEAEIIKWK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtcatgcttagatcttagcgaattccatactgatcagtatatagacatcaag
gaaagacttgtggctttggagaagcacttatcggaccctttttcagattgttatgttgaa
cgtctccttgatgtggttgtggcatgcgtcacagaatgtacaaaaactgtgaaaaacgtg
aaaaatgagaacatgttagcatttttgcaaagatttctcaatgtggcagtatgtttacag
tcatatcgtcgtaaaccggaagatttttcatttatcagttcattaggtcacggcgcattt
ggtcgtgttcaacttgttcgtgaaattacaacaggtcgtgtatgtgcgatgaaagtatta
aagaaatctcgaatgcttgcacaacacacagattattgggctgaaaaggaaattatgtca
catggtgaaagtccttggattgtacaattatattatgcttaccaagatttaaaaaatttg
tatatggttatggaatatgttcccggtggtaatcttgtcagttggatggatgaagtggag
ttcatgtcagaagcagcttgtcgattttatgcagccgaaacaattcttgctttaattgat
ttacatgcaatgggatttattcatcgtgatttaaaaccggacaatttattattagatgct
ggtggtcatttaaaattagctgatttcggtactgctatacgtgttgatccggaaacttca
ttaattcactgtgatgcagctgttggaacaccagattatcttagtccagaagttctttta
tcacagggaattggtggtgggagttatggattcgaagtggattggtgggcattaggtgtt
gttatttatgaaatgctttatggtgttacaccattctattcagaaacattagtcaatact
tatgctaatattatgaatcatgcaaatagtttgaaattccctgaaaatgttaatgtttcc
gatgcttgtttggacttcatgaaaaaacttctctgtgatcgtactcaaagacttggtagt
caagctcattgtttatctgaagtatataatcatccttggttttcgattgactggattcaa
tcccaacagaccgatggacatttagattctatggatgtatcaattgctgactggacatgg
tctaatatacgtgcttctcgtgcgccgtttcaacctcatttacgtagtgaaactgatacg
tcttattttcaaccagaaactgatgacgaagatgatgaattaatggtagatggtgaaaat
gtagttgataaagattcttctaaccatggacgaaataatgggcatgattcagaactagta
gatgtaacaaataacaacaataatggaaaatgtaaagatgtagctagaggtggtgacttt
cctgaatcatctaacagtgatcataaatattctggacgttgttccgatagtttgttagaa
ttgccaggaagtcaattagtgtttgctggtttctcattctcctcctctcatccacaccat
ttggctttgctgaacggactacattcatctccattacgtggatcgaatctgacagcatcg
gcatcatcatcagatctactcaagaatggtgataatattaataataatagcaataaatta
ggctcagttcaacttgataaatcaatgaatcatcaattacaagaaaataaatgtgataat
tgtaaaaattctttcctgaaatctaatggtgatgttagcagtataaataatttattaata
aataatgaaaatgaaaatgtaatggattcaaatatttctaatcatacaaaatgtgaatca
cagctagctggtttacgaattcaattagacgatgcgttaacattgtcggatacacattta
aatgaaatcagctcattaactgtacaattagaacaagctaacgctcgatgtcatgaattg
gaaaataagttatctttacaagaaattaatttcaaaaaaatccatgaagaaatggaaagg
caactggaaaatgttcatgcagaagccgctaaaaatcgttcatatttagaagcagaaatt
atcaaatggaag

DBGET integrated database retrieval system