KEGG   Schistosoma haematobium: MS3_09439Help
Entry
MS3_09439         CDS       T05004                                 

Definition
(RefSeq) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
shx  Schistosoma haematobium
Pathway
shx00030  Pentose phosphate pathway
shx00480  Glutathione metabolism
shx01100  Metabolic pathways
shx01200  Carbon metabolism
Module
shx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MS3_09439
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MS3_09439
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shx04147]
    MS3_09439
Enzymes [BR:shx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MS3_09439
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MS3_09439
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MS3_09439
  Exosomal proteins of colorectal cancer cells
   MS3_09439
  Exosomal proteins of bladder cancer cells
   MS3_09439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_N ATP-synt_E_2
Motif
Other DBs
NCBI-GeneID: 24596616
NCBI-ProteinID: XP_012800706
UniProt: A0A095B1F4
Position
Unknown
AA seq 163 aa AA seqDB search
MSEVNGSECEEFLNIIKLSLEEDKSHVHVVVIIGASLSSSPCQKYEEFWDYNFYLRGDYT
NPKTFELLNKFIESKWEQSVNRIFYYAIPPSVYKPVSSSIKEYCTNKNPDTWTRLIIEKP
FGRDLESFNELNSELTKLFTEEQIYRIDHYLGKEMVQNLLILR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtaaacggaagtgaatgtgaagaattcttgaacattattaagttgtctttg
gaggaagataaaagtcatgttcatgttgttgtgatcatcggagcctctctctcatcatct
ccatgtcaaaaatatgaagaattttgggactataatttttacttgagaggagattatacg
aatccaaaaacatttgaattactaaataagtttatagagtccaagtgggaacaatctgtt
aatcgcatattttattatgctataccaccatcagtttataaacctgtttcatcatctatc
aaagaatattgtactaacaaaaaccctgatacgtggactcgattgatcattgaaaaaccg
tttggacgagatttagagtcatttaatgaattgaattctgaattaactaaactgtttaca
gaagaacagatttatcgaatcgaccattatttgggcaaagagatggttcaaaatctacta
attttacggtaa

DBGET integrated database retrieval system