KEGG   Schistosoma haematobium: MS3_09758Help
Entry
MS3_09758         CDS       T05004                                 

Definition
(RefSeq) Titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shx01001]
    MS3_09758
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shx04131]
    MS3_09758
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shx04812]
    MS3_09758
   04147 Exosome [BR:shx04147]
    MS3_09758
Enzymes [BR:shx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MS3_09758
Protein kinases [BR:shx01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   MS3_09758
Membrane trafficking [BR:shx04131]
 Others
  Actin-binding proteins
   Others
    MS3_09758
Cytoskeleton proteins [BR:shx04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     MS3_09758
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS3_09758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N Tissue_fac fn3_2
Motif
Other DBs
NCBI-GeneID: 24596921
NCBI-ProteinID: XP_012801017
UniProt: A0A094ZAI5
AA seq 3485 aa AA seqDB search
MEVEQVTLTVDEVSPRMESLTSSAEERVVSEAVPLEETVYDVYETEQVEAVTRPTTDAVA
SGVVSSTTPSLSDVVSAEEVPSEATPSTPVNIKVIIIPPESPSSKSKLHINWQQPDDIPV
TNFYIELKPSNSKTWQDVSADFTITEPDAILPTDNLQEFVSYEFRVIAENEEGKSHPSLP
SNSIELGIPLEFIRPLTDITVSAVTNEPVILECELSRTPREKIQWFKDGKALPSRLSSRI
KVEELENGKVHRIIFSPLTEEDLGVYSVKVENLTSEARVDMKIAPTLKLSESFSDKVIMK
AGEAAVFEIPFVASPKPTVTWSWRPRTRPDAELGSAQTPRFKADVVSGLTSLPVSKVKRE
DAGEYSVVISNELGEVTVSIELIVLDKPSVPRNLVASDNTGESALFSWTEPEFLGLHPDV
GVSDGLSYVVEMRESNQRASRSVTVTSELNTLIDKLQVNKSYVFSVAAKNDVGQSEFAET
SPVSTKLEYGPPSSPVNVKAVVNPPKASIKDQTIELTWEQPTDQVSASGPVTNFYIELKP
EDSTRWQDVSADFTITEPHFTLPTDKLQEFVSYEFRVTSENKTGKSKPSSPSNAVQLGIP
LEFIRPLTDITVSAVTNEPVILECELSRTPREKIQWFKDGKALPSRLSSRIKVEELENGK
VHRIIFSPLTEEDLGVYSVKVENLTSEARVDMKIAPTLKLSESFSDKVIMKAGEAAVFEI
PFVASPKPTVTWSWRPRTRPDAELGSAQTPRFKADVVSGLTSLPVSKVKREDAGEYSVVI
SNELGEVTVSIELIVLDKPSVPRNLVASDNTGESALFSWTEPEFLGLHPDVGVSDGLSYV
VEMRESNQRASRSVTVTSELNTLIDKLQVNKSYVFSVAAKNDVGQSEFAETSPVSTKLEY
GPPSSPVNVKAVVNPPKASIKDQTIELTWEQPTDQVSASGPVTNFYIELKPEDSTRWQDV
SADFTITEPHFTLPTDKLQEFVSYEFRVTSENKTGKSKPSSPSNAVQLGVPLEFVRPLTD
LTVDKVTNEPVILECELSRTPRDKVQWLKDGKPIGRLPDRVTIEELENGKIHRVNLTSLM
DDDLGVYSLRVEKLSSECRLDMKVPPTLRLSDSFSDRVIIKAGGAMVFEIPFTASPKPKV
EWTWRQRSRPDGELGPVQSPRFKADVVSGLTSLPVSKVKREDAGDYTVVISNELGEVSVT
IQMIVIDKPSVPRDLEVSENSGESVLLSWKEPEFVGLSTTTTTDVSVSGAGGLLEYVVEM
RESSQRAGRGVRKTSELSVRIDDLQINKSYVFSVAAKNDVGQSEFAETKPVSTKLDYGPP
SSPVNVKAVVNPPKASIKDQTIELTWEQPTDQVSASGPVTNFYIELKPEDSTRWQDVSAD
FTITEPHFTLPTDKLQEFVSYEFRVTSENKAGKSKPSSPSNAIRLGVPLEFVRPLTDLTV
DKVTNEPVILECELSRTPRDKVQWLKDGKPIGRLPDRVTIEELENGKIHRVNFTSLMDDD
LGVYSLRVEKLSSECRLDMKVPPKLRLSDSFSDRVIIKAGGAMVFEIPFTASPKPKVEWT
WRQRSRPDGELGPVQSPRFKADVVSGLTSLPVSKVKREDAGDYTVVISNELGEVSVTIQM
IVIDKPSVPRDLEVSENSGESVLLSWKEPEFVGLSTTTTTDVSVSGAGGLLEYVVEMRES
SQRAGRGVRKTSELSVRIDDLQINKSYVFSVAAKNDVGQSEFAETKPVSTKLDYGPPLSP
VNVKAVVNPPKASIKDQTIELTWEQPTDQVSASGPVTNFYIELKPEDSTRWQDVSADFTI
TEPHFTLPTDKLQEFVSYEFRVTSENKAGKSKPSSPSNAVQLGIPLEFVRPLIHVTVNEV
DEKPVVLECELSRSPRDKVQWLKDGKSLSRLPNHVSVEESSDKKIHSIKFRSLTDDDLGV
YTIKVEKLSSEAKLSMKVPPTLRLSDSFSDRVIIKAGGAMVFEIPFTASPKPKVEWTWRQ
RSRPDGELGPVQSPRFKADVVSGLTSLPVSKVKREDAGDYTVVISNELGEVSVTIQMIVI
DKPSVPRDLEGSEKRGESVLFRWQEPELVAVSVSGAGGLLEYVVEMRESSQRAGRGVRKT
SELSVRIDDLQINKSYVFSVAAKNDVGQSEFAETKPVSTKLDYGPPTPPLNVTASVSPSY
AEPEDQMITVNWSEPETATTTTTSTGSSPLYYTVEYRVDEGRVWNKLVCGKEVTGMKLDF
PPIKENLSAGKSYDFRVIAVNKAGTSEPSKPSNSIQLGIVLEFIRQLEDLIITNIEPIEY
KLECELSRKPRTMIAWTKDNKPLIIRPDDTHMKFIDQGTIQSIHFTHLIDTDIGDYAIQV
ENISSKCKLEIKAPPTIRISDQFEDHITLKAGTTKILEIPFISSPKPKIKWTWAPSTDLT
QEQTPRFKPDIVAGLTTLPLSRVKREDSGAYKVKISNDLGEISITIHVIVIDKPSPPRNL
TITDATEKSVMFNWDLPVNVNENESLEYVVNYRDATKYSSQPINVCVTKELKTFIDGLKL
GSQYIFSVCARNEVGDSAFAESQAFLMKYSFDPPEAPGIPQVTILESGHVSLEWTPPSSD
GGSPITEYFIESMDERPVVKGRRRTSTYGSRAQWNSLTSGIIFEPNVQPKASVTGLSPDK
QYTFRVCAVNKAGKGPFSPPSESCLPLIKPPKVPGKPGPITVGPLNETSVNLSWTPGTVN
EDFGPADYYIIEACEDDGNDWKEVGKTTKPDDCNLNVNNLDSSTRYQFRVRGVNKEGVGE
PSKPSERICLKKDAPLVITKELESIHLNEIPQTIEYECHLSKLPQKVQWFYNNKRLDTSN
LRKYRFIDDGKIQKLEVLKITLNDVGEYSIKIDKLESKATFEIDLPPKLCLPDDFSDTII
LAQGNNRNIEIPFTSCPPATSIVWYWNGSRTLPDPTKRTVPDNDSKSQVVLRLTAVQVSD
AGIYEAIITNPYGEAKATVTLKVLGVPGPVTSLEAHVESPTEVSVLWKPPEDDGGSPLTG
YKVEQRQLAPEPGGVLRSQAKEWKLIANVSLKSKTSNDEEPFVHRITGLTEGATYLFGVS
AVNDCGSGPRKEISDGLIMKSPYDIPEIPKQLTAKPINHSTIELEFKLPVTHVEAPLTSV
IVEYRPKSVSRWKTQTFEPCSIVQIDKLEANTEYEFRVSCTNLAGKSESSNPVKAKTKQL
PKPPDAPKLDNVTPVNTNSVKVNWFSPTNDGDSPITSYQIEMCDANNGTEVWKPIDALNI
DRTDQSLLSPDEQKSYELIVKNLDNSKSFKFRVIAVNSIGPGKPSRSSQPVTPGIEVNII
RPLNNVCFDEIPKSGTKVELECELSQSNCRVNWLYNGKPIVLGKKYDFSPEGNVYRLIIN
DITLEDMGVYELNYKKLKTQCKVEAKIPPTLLEDTEESHTRRINVGSNCVFEVPFKAYPK
PTIKWLAQNIPITDKTKRYQVNIVAGLTSLSIQRVQNDDTGQLIVIIENEHGKLTWKCEL
IVIGK
NT seq 10458 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggagcaggtgactttgaccgtggatgaggtgtcacctcgtatggaatccctg
acgtcctcagctgaagaacgtgttgtcagtgaggctgttccactggaggagacggtctat
gatgtgtacgaaacggaacaggttgaagctgtaacacgtcctaccactgacgctgtcgct
tctggtgttgtctcctcgactactccttctctgtctgacgttgtcagtgctgaagaagtt
ccttctgaggcgactccttcaactcctgtcaatataaaagttattataattccaccagaa
agtccatcttcaaaatctaaacttcatataaattggcaacaacctgatgatattccagtc
actaatttttatatagaattaaaaccatcaaattccaaaacatggcaagatgtatctgct
gatttcactattactgaacctgatgcaattctgccaactgataacttgcaagaatttgtc
agttatgaatttcgtgttattgctgaaaatgaagaaggcaaaagtcatccgtcattacca
tcgaattcaatagaattaggtataccgctagaattcattcgcccactgacggatataact
gtcagcgcagtgacaaatgaaccagtcatacttgaatgtgaactatctcgaactccacgt
gaaaagatccaatggtttaaggatggaaaagcactacccagcagactgtcgagtagaata
aaagttgaagagttggagaatggaaaagttcaccgaattatcttcagtccattgacagag
gaagatctaggtgtttattctgtgaaagtagagaatttgacaagtgaagcacgagtggat
atgaagattgcaccaacactgaagctgtcggaatcattctctgacaaagtcatcatgaaa
gcaggagaggcggccgtcttcgaaataccattcgtcgccagtccgaaaccaacagtgacc
tggtcatggaggccaagaacacgtcctgatgcggagttgggatcagctcagactccacga
tttaaggctgacgtggtgtccggactgacatcacttccagtgagtaaggtgaagcgtgaa
gatgctggtgagtacagtgtggtcatcagtaatgaattgggcgaggtgacagtgagcatt
gagttgattgtattggacaaaccatctgtacctcgcaatttagttgcgagtgataacact
ggtgagagtgctttgttcagttggacggaaccagaattcctcggtcttcatcctgatgta
ggagttagtgatggattgagttacgttgtcgagatgcgtgagtcaaatcaacgtgcgagt
aggtcggtgacagtgacgagtgaattgaatactcttatagacaaattgcaagtgaacaag
tcgtatgtgtttagtgttgcagctaaaaatgatgtcggtcagtcggaattcgctgaaacg
agtccagtttcgacgaagttggaatatggtccaccatcgagtccagtcaatgtgaaggca
gtcgtcaatccaccgaaggcgtctatcaaagatcaaacgatagaattgacgtgggaacaa
ccaaccgaccaagtgtctgccagtggaccggtcacaaacttctacatcgaattgaagcct
gaagattcaactcgatggcaggacgtgagtgccgacttcacaatcactgaaccacatttc
acacttcctactgataaattgcaagagtttgtgagttatgagttccgtgtaacatcagag
aataaaactggcaagagtaaaccttcttcaccatcgaacgctgttcaactaggtataccg
ctagaattcattcgcccactgacggatataactgtcagcgcagtgacaaatgaaccagtc
atacttgaatgtgaactatctcgaactccacgtgaaaagatccaatggtttaaggatgga
aaagcactacccagcagactgtcgagtagaataaaagttgaagagttggagaatggaaaa
gttcaccgaattatcttcagtccattgacagaggaagatctaggtgtttattctgtgaaa
gtagagaatttgacaagtgaagcacgagtggatatgaagattgcaccaacactgaagctg
tcggaatcattctctgacaaagtcatcatgaaagcaggagaggcggccgtcttcgaaata
ccattcgtcgccagtccgaaaccaacagtgacctggtcatggaggccaagaacacgtcct
gatgcggagttgggatcagctcagactccacgatttaaggctgacgtggtgtccggactg
acatcacttccagtgagtaaggtgaagcgtgaagatgctggtgagtacagtgtggtcatc
agtaatgaattgggcgaggtgacagtgagcattgagttgattgtattggacaaaccatct
gtacctcgcaatttagttgcgagtgataacactggtgagagtgctttgttcagttggacg
gaaccagaattcctcggtcttcatcctgatgtaggagttagtgatggattgagttacgtt
gtcgagatgcgtgagtcaaatcaacgtgcgagtaggtcggtgacagtgacgagtgaattg
aatactcttatagacaaattgcaagtgaacaagtcgtatgtgtttagtgttgcagctaaa
aatgatgtcggtcagtcggaattcgctgaaacgagtccagtttcgacgaagttggaatat
ggtccaccatcgagtccagtcaatgtgaaggcagtcgtcaatccaccgaaggcgtctatc
aaagatcaaacgatagaattgacgtgggaacaaccaaccgaccaagtgtctgccagtgga
ccggtcacaaacttctacatcgaattgaagcctgaagattcaactcgatggcaggacgtg
agtgccgacttcacaatcactgaaccacatttcacacttcctactgataaattgcaagag
tttgtgagttatgagttccgtgtaacatcagagaataaaactggcaagagtaaaccttct
tcaccatcgaacgctgttcaactaggcgttccactcgaatttgtacgaccactaactgac
ttgactgttgacaaagtaaccaatgaaccagtcatccttgagtgtgaactatctcgtact
cctcgtgataaagtacaatggttgaaggatgggaaacctattggtcgtctaccagaccgt
gtgacaattgaggagttggagaatggaaaaatccatcgtgtgaatttaacttcattaatg
gatgatgatttgggtgtatatagtttacgtgttgagaagttatctagtgaatgtcgacta
gatatgaaggtaccgccaacattgagattatccgattcgttctccgatcgagtgatcatc
aaggctggaggtgctatggtgttcgaaataccattcactgccagtcctaaaccaaaagtc
gaatggacatggagacagcgaagtcgaccagatggtgaattgggaccggtacaaagtcca
cgattcaaggctgacgtggtgtcgggattgacttcattgcctgtgagtaaggtgaagcgt
gaggatgccggtgactacacagtggtgatcagtaacgagttgggtgaagtgtctgtgacg
attcagatgattgtgattgacaagccatccgtacctcgtgatctggaggtgagtgagaac
agtggtgaaagtgtgttgttgagttggaaggagcccgaattcgttggtttgtccacaacg
acgacgacggatgtgagtgtgagtggtgctggtggattgttggagtatgtggttgagatg
cgtgagtctagtcaacgtgctggtcgtggagtgagaaaaacgagtgaattgagtgttagg
attgacgatcttcagatcaacaagtcgtatgtgtttagtgttgcagcgaagaatgatgtc
ggtcaatcagagtttgcagaaacgaaaccagtttcaactaaattagattatggtccacca
tcgagtccagtcaatgtgaaggcagtcgtcaatccaccgaaggcgtctatcaaagatcaa
acgatagaattgacgtgggaacaaccaaccgaccaagtgtctgccagtggaccggtcaca
aacttctacatcgaattgaagcctgaagattcaactcgatggcaggacgtgagtgctgac
ttcacaatcactgaaccacacttcacacttcctactgataaattgcaagagtttgtgagt
tatgagttccgtgtaacatcagagaataaagctggcaagagtaaaccttcttcaccatca
aatgcaatacgattaggcgttccactcgaatttgtacgaccactaactgacttgactgtt
gacaaagtaaccaatgaaccagtcatccttgagtgtgaactatctcgtactcctcgtgat
aaagtacaatggttgaaggatgggaaacctattggtcgtctaccagaccgtgtgacaatt
gaggagttggagaatggaaaaatccatcgtgtgaatttcacttcattaatggatgatgat
ttgggtgtatatagtttacgtgttgagaagttatctagtgaatgtcgactagatatgaaa
gttccaccaaaattgagattatccgattcgttctccgatcgagtgatcatcaaggctgga
ggtgctatggtgttcgaaataccattcactgccagtcctaaaccaaaagtcgaatggaca
tggagacagcgaagtcgaccagatggtgaattgggaccggtacaaagtccacgattcaag
gctgacgtggtgtcgggattgacttcattgcctgtgagtaaggtgaagcgtgaggatgcc
ggtgactacacagtggtgatcagtaacgagttgggtgaagtgtctgtgacgattcagatg
attgtgattgacaagccatccgtacctcgtgatctggaggtgagtgagaacagtggtgaa
agtgtgttgttgagttggaaggagcccgaattcgttggtttgtccacaacgacgacgacg
gatgtgagtgtgagtggtgctggtggattgttggagtatgtggttgagatgcgtgagtct
agtcaacgtgctggtcgtggagtgagaaaaacgagtgaattgagtgttaggattgacgat
cttcagatcaacaagtcgtatgtgtttagtgttgcagcgaagaatgatgtcggtcaatca
gagtttgcagaaacgaaaccagtttcaactaaattagattacggtccaccactgagtcca
gtcaatgtgaaggcagtcgtcaatccaccgaaggcgtctatcaaagatcaaacgatagaa
ttgacgtgggaacaaccaaccgaccaagtgtctgccagtggaccggtcacaaacttctac
atcgaattgaagcctgaagattcaactcgatggcaggacgtgagtgccgacttcacaatc
actgaaccacacttcacacttcctactgataaattgcaagagtttgtgagttatgagttc
cgtgtaacatcagagaataaagctggcaagagtaaaccttcttcaccatcgaacgctgtt
caactaggtattccactagaatttgttcggccgttgattcatgttactgtaaatgaggtt
gatgaaaaaccagttgtattggaatgtgaattatctcgttcaccacgtgataaggtacaa
tggttaaaagatggtaaatctctaagccgtttaccaaaccatgtatcagttgaagaatca
agtgataaaaaaattcactctattaagttccgctccttaactgatgatgatttgggcgtc
tatacgataaaagtagaaaagttatcaagtgaggcgaaactttcaatgaaagttccacca
acattgagattatccgattcgttctccgatcgagtgatcatcaaggctggaggtgctatg
gtgttcgaaataccattcactgccagtcctaaaccaaaagtcgaatggacatggagacag
cgaagtcgaccagatggtgaattgggaccggtacaaagtccacgattcaaggctgacgtg
gtgtcgggattgacttcattgcctgtgagtaaggtgaagcgtgaggatgccggtgactac
acagtggtgatcagtaacgagttgggtgaagtgtctgtgacgattcagatgattgtgatt
gacaagccatccgtacctcgtgatctggaggggagtgagaaacgtggtgaaagtgtgttg
ttcaggtggcaggagcccgaactcgtagctgtgagtgtgagtggtgctggtggattgttg
gagtatgtggttgagatgcgtgagtctagtcaacgtgctggtcgtggagtgagaaaaacg
agtgaattgagtgttaggattgacgatcttcagatcaacaagtcgtatgtgtttagtgtt
gcagcgaagaatgatgtcggtcaatcagagtttgcagaaacgaaaccagtttcaactaaa
ttagattacggacctccaactcctccattgaatgttactgcatctgtatctccgtcatat
gctgaaccagaagatcaaatgataacagtgaattggtccgaacctgaaacagcaacaaca
acaacaacatctactggatcatctccactttattacaccgtagagtatagagtagatgaa
ggacgtgtttggaataaattagtctgtggtaaagaagttactggtatgaaactagatttt
cctccaattaaagaaaatttgagcgctggtaaatcatatgacttcagagttatagctgta
aataaagctggtacaagtgaaccgtcaaaaccatcgaattcaatccaactaggtatagta
cttgaatttatacgtcaattagaagatttaattataactaacattgaaccaattgaatat
aaattagaatgtgagttatcacgtaaaccaagaacaatgatagcttggacaaaagataat
aaaccattaattataagaccagatgatactcatatgaaatttattgatcaaggcacaatt
caatcaattcattttacacatttaattgatacagatattggtgattatgcaatacaagta
gagaatatttcatcaaaatgtaaattagaaattaaagctccaccaacaattcgaatatct
gatcaatttgaagatcatattactttaaaggctggtactacaaaaattctagaaatccca
tttatatcttcaccaaaacctaaaattaaatggacatgggcaccaagtactgacttgact
caagaacaaacccctagatttaaaccggatatagttgctggtttaactacattacctcta
agtcgagtgaaacgtgaagatagtggagcatataaagttaaaatatcaaatgatcttggt
gaaatttccataacaattcatgtcattgttattgataaaccatctccaccaagaaatctt
acaataactgatgctacagaaaaatcagtcatgtttaattgggatctaccagttaatgta
aatgaaaatgaatctttagaatatgttgttaattatcgagatgcaaccaaatattcaagt
caaccaattaatgtttgtgtaacaaaggaattgaaaacatttatagatggtcttaaactg
ggatctcaatatatattctcagtttgtgcacgaaatgaagttggtgattccgcctttgct
gaaagtcaggcattcttaatgaagtattcttttgacccacctgaagctccaggaatacct
caggttactatattagaaagtggtcatgtttcactggaatggacacctccttcatcagac
ggtggttctccgatcacagagtatttcattgaaagcatggatgaacgtccagttgtaaaa
ggccggcgccggacatcgacctatggttctcgagcacagtggaattcactaacttcagga
atcatatttgaacccaatgttcaaccgaaagcttcagtaactggtttgtctcctgataaa
caatatacattccgtgtatgtgctgttaataaagctggtaaagggccatttagtccacca
tcagaatcttgtttacccttaataaaacctcctaaagttcctggaaaacctggtcctata
accgtcggacctttaaatgaaacaagtgtcaatttaagttggacacctggtactgtaaac
gaagactttggaccagctgattattatataattgaagcttgtgaagatgatggtaatgac
tggaaagaagttggaaagacaaccaagccagatgattgtaacttgaacgtgaacaatcta
gacagttcaacacgttatcaatttcgtgttcgtggagtgaataaagaaggtgtcggtgaa
ccatcaaaaccatcagaaaggatttgtttaaagaaagatgctccattagttataactaaa
gaattagaatcaattcatttgaatgaaattccacaaacaatcgaatatgaatgtcatctt
tctaaattaccacaaaaagttcaatggttctataataataaacgtttagatacatcaaat
ttacgtaaatatcgttttattgatgatggtaaaatacaaaaattagaagtattaaaaatt
acattaaatgatgttggtgaatattctattaaaattgataaattagaatcaaaggcaaca
tttgaaattgatttaccacctaaactctgtctaccagatgatttctctgatacaatcata
cttgctcagggaaataatcgtaatatagagataccatttacttcttgtccacctgctacc
agtattgtttggtattggaatggtagtcgtactctgcctgatccaacaaaacgaactgtt
ccagataatgattcaaagtctcaagtggtacttcgtctcactgcagtacaagtttctgat
gctggaatttatgaagctattatcactaatccatatggagaagctaaagcaaccgtaaca
ttgaaagttcttggagtccctggtccagtaacatcattggaagcacatgttgagtcacct
acagaagtatctgttttatggaaaccacctgaagatgatggcggtagcccattgacagga
tataaagtcgaacaacgtcaattggctcctgaacctggaggtgttttacgttctcaggct
aaggagtggaagttaattgcaaatgttagtttgaaatcaaaaacatctaacgatgaagaa
ccatttgtacatcgtatcacagggttaactgaaggagccacttatttgtttggtgtttct
gcagttaatgattgtggaagtggaccaaggaaagaaatttccgatggcttgataatgaaa
tctccttatgatattccggaaatcccaaaacaacttactgctaaaccaataaatcattcc
actattgaattagaattcaaattaccagtcactcatgtggaagcgccattaactagtgta
attgttgaatatcgtcctaaaagtgtatcaagatggaaaacccaaacatttgaaccatgt
tctatagtacaaattgataaacttgaagcaaatacagaatatgaatttcgtgtaagttgt
actaatttggctggtaaaagtgaatcatcaaatcctgttaaagctaaaacaaaacaattg
ccaaaacctcctgatgctccgaagcttgacaatgttacaccagtcaatacaaactcagta
aaagtcaattggttttctccaacaaatgatggtgacagtccaattacatcatatcaaata
gagatgtgcgatgctaacaatggcactgaagtatggaaaccaattgatgctttaaacata
gatcgtacggatcaaagtttactatctccagacgaacaaaagtcatatgagttgattgtg
aaaaatttagacaattccaaatctttcaaatttcgtgttattgctgtgaatagtatagga
ccaggtaaaccgtctagaagttcacaacctgttacacctggaattgaagtcaatattatt
cgaccattgaataatgtttgttttgatgaaattccaaaatctggaacaaaagttgaatta
gaatgtgaattaagtcaatctaattgtcgagtaaattggttatataatggaaaaccaatt
gtattgggcaagaaatatgatttctctccagaaggaaatgtttatcgattaattattaat
gatataacacttgaagatatgggagtttatgaattgaattataagaagttaaaaacacaa
tgtaaagtagaagctaaaattccaccaacacttcttgaagatactgaagaaagtcataca
cgtcgtattaatgttggttcaaattgtgtatttgaagtaccatttaaagcttatccaaaa
cctactataaaatggcttgctcaaaatatacctattacggataaaacaaaacgttatcaa
gttaatatagtagctggtttaacatcattatctatacaacgtgtacaaaatgatgatact
ggtcaattaattgttatcattgaaaatgaacatggaaaattaacatggaaatgtgaacta
attgttattggtaagtga

DBGET integrated database retrieval system