KEGG   Schistosoma haematobium: MS3_10635Help
Entry
MS3_10635         CDS       T05004                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:shx03021]
    MS3_10635
Transcription machinery [BR:shx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     MS3_10635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 24597771
NCBI-ProteinID: XP_012801875
UniProt: A0A095CGG1
Position
Unknown
AA seq 596 aa AA seqDB search
DSSFEDESGDEHDGYDPVRSRIVDNQNVSYKPRYNSGSDDLSDDLEDHLSYSHNPPHSPV
DSSSEHSIVKSEQNHFSENLDYDREYHVEPVVDVTTPGYAPSQALTPESSPALSYSGSEH
ASDVNVTRKTDPNISSEVHQEDEVEHESNDDSESVSEKDQQEFHQQEVDETPQVNSVEKY
PTTKHNSPIESLQYNNFPDIFEDHDDDQDQGKFNEDFEGFERDEQPESQVDGIIADIFGE
SDAEEEFEGFAENELDKGIEEEVEVQTSSELVTKKGPLTTAGENEGDEESEHDDEFVSDF
DRIMEKKKEESRRRRRRNRDIEFLNDSDDLIVETISRMKSAADEDRQLLTASRPATKKLN
MLKEVLAILRRADLKSALIENGMLSAITEWLSPLPGHTLPNLVIRDSMLTSLSEFQSLSS
EVLQESGIGKALMYLYKHPRETRENKDRAGRLINEWLRPIFNLTSDYRTLTKEERKQLDY
EHLPKRRNIELLRPGDPGWVNRARVPQPSNKDYIIRPKWRVRENATGDDNDEEGNDDQTE
QSQSLSRKHRKTRTSGFGATSRIESHIRNLSNSARKSHAKAARAVPMSIEGRNMSL
NT seq 1792 nt NT seq  +upstreamnt  +downstreamnt
ggattcaagttttgaagatgagtctggtgatgaacatgatggttatgatcctgttcgcag
ccggattgtggataatcaaaatgtatcatataaacctagatataattcgggctctgacga
tctaagtgatgatctggaagatcacttatcttattctcataatcctccacattctccagt
tgattcttcgagtgagcattcgatcgttaaatctgaacaaaatcatttttcggagaatct
ggattacgatagggaatatcacgttgaacctgttgtggatgtcactaccccaggttatgc
tccaagtcaggctttaactcccgaatccagtcctgccctgagttattccggaagtgaaca
tgcatcagatgtaaatgtgactaggaaaactgatccaaatatttctagtgaagtgcatca
ggaagatgaagtcgaacacgagagcaacgatgactcagagtctgtaagcgaaaaagatca
gcaagagtttcatcaacaggaagtcgatgaaactcctcaagtgaattctgtagagaaata
tcccacaaccaagcataattctcctatcgaatcactccagtataataatttccctgacat
ttttgaagatcatgatgatgatcaagatcaaggtaaattcaatgaagacttcgaaggttt
tgagagagatgaacaaccagaatctcaagtggatggcatcatagcagatatatttggcga
aagtgatgcagaagaagaatttgagggcttcgccgaaaatgaactggacaaaggtattga
agaggaggttgaagttcaaacatctagtgagttagtaacaaaaaaaggtccccttacgac
agctggagaaaacgaaggggatgaagagtctgaacatgatgatgagttcgtttccgactt
cgaccggataatggaaaaaaagaaagaagaatcacgacgaagacgtagacgtaataggga
tattgaattccttaatgatagtgatgatttgattgttgaaaccatttctcgaatgaaaag
tgctgccgatgaagacagacagttacttacagctagtcgaccagcgaccaagaaactgaa
catgctcaaagaagtattagctattcttaggcgggctgacctgaaatccgccttaataga
aaatgggatgctttccgctataactgagtggctatcccctttacctggccatacactccc
gaatctcgttattcgtgactctatgttgactagtctcagtgagttccagtcactgtcatc
tgaagttcttcaagaatccggtatcgggaaagccttgatgtatttatacaaacacccgag
agaaactcgagaaaacaaggatagagctggaagacttattaatgaatggctccgacccat
attcaacttgactagtgactatcgaactctcactaaggaggaacgtaaacagctagatta
tgaacatttacctaagcggagaaacatcgaacttttgaggcctggcgatcctggatgggt
taatagagcccgagttcctcaaccgtcaaataaagattatattatccgaccaaaatggcg
tgttcgagagaatgctactggggatgataatgatgaagagggaaatgatgatcagacaga
acaatctcagtcactttctcgaaagcatcgaaaaacacgaacatctggttttggagctac
atcacgaattgaaagtcatattcgaaatttaagtaatagtgctcgtaaaagtcatgccaa
agctgctcgtgcagttccaatgagtattgaaggtcgtaatatgtcattgtga

DBGET integrated database retrieval system