KEGG   Schistosoma haematobium: MS3_10735Help
Entry
MS3_10735         CDS       T05004                                 

Definition
(RefSeq) Palmitoyltransferase ZDHHC5
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
shx  Schistosoma haematobium
Brite
KEGG Orthology (KO) [BR:shx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shx04131]
    MS3_10735
Enzymes [BR:shx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     MS3_10735
Membrane trafficking [BR:shx04131]
 Protein recycling
  Others
   GRIP associated proteins
    MS3_10735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC NnrU EI24
Motif
Other DBs
NCBI-GeneID: 24597864
NCBI-ProteinID: XP_012801967
UniProt: A0A095B4K8
Position
Unknown
AA seq 822 aa AA seqDB search
MSCQAFSKNIGPALIAWFLLIFLTVLYLVFICWDFSKETSYAFTVCHSLLFFFVVSAFGK
ATFMDPGYYAMGVPGEKMTTVEKGSPRTVMYKSVDINGVSTRLKWCVTCEFYRPPRCSHC
SICKHCIDTFDHHCPWLNNCIGKRNYRYFFSFLLTLTLHMIIVFGVSMTYVLMRTNELSH
YKVIIAIGVLILVGLLLLPVLGLTGFHIFLVSKGRTTNEQVTSKYDLDMNPYDRGLCKNW
LHIFCTSQPPILNRPNVAEVDMWEISYNGKPIKHRQTSNLRSGSNNYKLSDAFKSSKNPV
DIVKQGEVVCEKVDLEDIVNHSSDQRNTSEVISSVHHELNKSLSPNPQSKVLSLKEFSNA
THTNENLMSRSQSPVCGRTGELNKTNPNLALVGTKSKSLGNKDQGKSLLIGTNTPKYVSN
ENSASFNSNINSVVTSTNVPTKIISDRDRFGIKGDHLTPLLGSQANSDVDLIRGRQLQKL
TIENQSKSSNSLHLRQQDQSAATEIGRSSSRDFSSRSNENMCPCTSSNSMMNIRDRVTLP
ISSHGAPFSQPRAATAEQFSTPQDFNGTQCTSKSYSPSTGRGIHYVTSATLDCYTPESVN
LPTSNISRGFVKSMRSEQRRHEFPHQFYPRSPGMQVDQRHLLPHNEVANHLSPRSLHSLP
PPLPPHGSQTNISHARPFWPPAVPPHGISKSVPYFLPVDTASQFSNTTASSNLRLVKPPY
FSNPHGVQVDGSSYFIGSPRTNEQSASKFVSQSFGSTHCPSIMTQAGSRPTPPLPPHNRI
SKLNAPNNRMQSTGHRNSNHLVTRWQKDGDSNSPDGTFEISV
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgagttgccaagccttttcaaaaaatattggtccagctctgattgcttggtttctcctt
atatttcttactgttttgtatttagtgtttatttgttgggattttagcaaagaaactagt
tatgcatttactgtgtgtcattctttgctgtttttctttgtggtatctgcatttggcaag
gcaaccttcatggaccctggatattatgctatgggtgttcccggtgaaaagatgactact
gttgagaaaggttcccctcgtactgtaatgtataagtctgttgacataaatggagtttcc
acccgtttgaaatggtgtgtcacatgtgaattttacagacctcctcgctgttctcattgc
tctatttgcaaacattgcattgatacgtttgatcatcattgtccttggctgaacaattgt
attgggaaacgaaactatcggtattttttctcgttcctactcacattaactcttcatatg
attattgtttttggcgtgtccatgacgtatgttctaatgcgtacgaatgaactctctcac
tacaaagtcattattgccattggtgtgttaattttggtaggcttattgctgcttcctgtg
ctaggtctgacgggatttcacatttttttagtcagcaaaggacgaactacaaatgaacag
gtcacttcaaaatatgatcttgatatgaacccttatgatcgcggcctgtgcaagaactgg
ctacacattttttgtacctctcaaccacctatattgaatcgaccaaatgtagcagaagtt
gatatgtgggaaatatcctataatggtaaacctatcaaacaccgccaaacatcaaatttg
cgttctggttctaataactacaagctttctgatgcttttaaatcatctaaaaacccggtt
gatattgttaaacagggagaagttgtttgtgaaaaggtggatttggaagatatagttaat
cattcttctgatcaacgaaacacatccgaagtaatatcaagtgttcatcatgaattaaac
aaatctctttcacccaacccacaatcaaaagttttatcccttaaagagttttcaaatgca
acccacactaatgaaaaccttatgtctagatcgcaatctcctgtttgtggaaggactggc
gaattaaataaaacaaatccaaatcttgctttagtaggaacaaagtcaaagtctttaggt
aacaaagatcaaggtaaaagtctactgattgggacaaatacaccaaaatatgtatcaaat
gaaaatagtgctagctttaactctaatatcaattctgttgtaacatctactaatgtcccc
acgaaaatcatatccgatagagatcgtttcggcataaaaggtgaccatttaactccactt
ctaggatctcaagcgaattcggacgttgacttgattcggggacgtcaattgcaaaaactt
accatagaaaaccaaagtaagtcgagtaattcgcttcatctcagacaacaggatcagagt
gccgctaccgaaattggaagaagttcttcacgtgatttttcttctcgttccaatgaaaat
atgtgtccttgtacatcatctaattcgatgatgaatatccgcgatcgagtcaccctaccg
ataagttcacatggtgcgccattttctcaaccgcgtgctgctactgccgaacaattcagc
actcctcaggattttaatggtacacagtgtacatctaaatcttactctccttcaacaggt
cgtggtatacattatgtcacgtcagctacacttgattgttacacccctgaatctgtaaat
ctaccaactagcaatatatcgaggggttttgtgaaatcaatgagatctgaacaacgccgt
catgaatttccgcaccagttttatcctcggtctcctggaatgcaagtagatcaaagacac
ttactaccccataatgaagttgccaatcatttatctccacggtcacttcacagtcttcct
ccacctctacctcctcatggctcccagacaaatatttctcatgctcgtccattttggcct
ccagctgtacctcctcacggtatttctaaatcagtaccatatttcttgccggttgataca
gctagtcaatttagtaataccacagcatcctctaatcttcgtttggtcaaaccaccttat
ttcagtaatcctcatggggttcaagtggatggatctagttacttcataggtagtccacgt
acaaatgagcagtcagcttcaaaatttgtatctcagtcatttggttcgactcattgtcct
tcaattatgacacaagctggttcacgtcctacgccaccattacctccgcataatcgaatt
tctaaactgaatgcaccaaacaatcgaatgcaatcaactggacataggaattctaatcat
ttagtcacacgatggcaaaaggatggtgattctaattctcctgatgggacttttgaaatt
tcagtttag

DBGET integrated database retrieval system