KEGG   Schistosoma haematobium: MS3_11211Help
Entry
MS3_11211         CDS       T05004                                 

Definition
(RefSeq) Arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
shx  Schistosoma haematobium
Pathway
shx00220  Arginine biosynthesis
shx00330  Arginine and proline metabolism
shx01100  Metabolic pathways
shx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MS3_11211
   00330 Arginine and proline metabolism
    MS3_11211
Enzymes [BR:shx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MS3_11211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 24598327
NCBI-ProteinID: XP_012802434
UniProt: A0A094ZCA7
AA seq 138 aa AA seqDB search
GIQLIDCGDVTPVELSETEDPQRFGMKWSRSFSLTTLKIAERVEGLMKQSTKHNTESNES
KSTPLVIVGGDHSMATGTILGHAKAKPDLCVLWIDAHGDINTPLNSASGNIHGMPLSFLV
KELQDQIPWLDDFEGIKP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ggaatacagttaattgattgtggagatgttacacctgtagaactaagtgaaacagaggat
ccacaacgttttggaatgaaatggtcacggagtttctcattgaccactttaaaaatagcc
gaacgtgtggagggattaatgaaacagtcaactaaacataatactgaatcaaatgaatca
aaatcaactcctttagtaattgttggtggtgatcatagtatggcaactggaaccatactt
ggacatgctaaagctaaaccagatctgtgtgtgttatggattgatgctcatggtgacata
aatacaccactgaattcagcttctggaaatatacatggaatgcctttaagttttctagta
aaagaattacaagaccaaataccgtggttggacgactttgaaggcataaaacct

DBGET integrated database retrieval system