KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_1397Help
Entry
SHJG_1397         CDS       T02063                                 

Definition
(GenBank) oxygenase
  KO
K18058  L-asparagine oxygenase [EC:1.14.11.39]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Brite
KEGG Orthology (KO) [BR:shy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SHJG_1397
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.39  L-asparagine hydroxylase
     SHJG_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauD CsiD
Motif
Other DBs
NCBI-ProteinID: AEY86673
UniProt: H2K4S2
Position
1676598..1677566
Genome map
AA seq 322 aa AA seqDB search
MTATEQRGAQLTGPELADISRIAQGLLERAPDRVDDPAWVADARRAWEETPGRLRGLVRE
FRRDSGADGRLLLTGLPIRPERLPGTPTVMGSAQRTPALPAALLMLIAHGLGDPASFAAE
KNGALVQDVVPVPGQEEFQGNAGSVELTFHTENAFHPHRPDYVLLLCLRTDHEGQAELRT
CCSRRVLPRLTDRTREALARPEFVTDPPPSFGGGGTGSLHGILTGDPEDPDLCYDESATR
ALTPAGRAALQELSAVIRTSYDGIRLRAGDLAVVDNRVTLHGRSSFVPRFDGGDRWLQRT
FAFTDLRRSRDHRPADGNVLVK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccgaacagcgcggggcgcagctgaccggccccgagctggcggacatctcg
cggatcgcgcagggcctgctggaacgggcgccggaccgggtcgacgacccggcctgggtc
gccgacgcccgccgcgcctgggaggagacccccggccggctgcgcggactggtacgggag
ttccgccgggactcgggcgccgacggcagactgctgctcaccggactgccgatccgcccg
gagcggctgcccggcaccccgaccgtcatgggctcggcgcagcggacccccgcgctgccc
gcagcgctgctcatgctgatcgcccacgggctgggcgatcccgcctcgttcgcggccgag
aagaacggcgccctggtgcaggacgtcgtccccgtgcccggccaggaggagttccagggc
aacgcgggctccgtggagctgacgttccacaccgagaacgccttccacccgcaccggccg
gactacgtcctgctgctctgcctgcgcaccgaccacgagggacaggcggagctgcgcacc
tgctgctcgcggcgggtgctgccccggctgacggaccgcacccgcgaggcactggcccgc
cccgagttcgtcaccgaccccccgccctccttcggcgggggcggcaccggaagcctgcac
ggcattctcaccggcgacccggaggaccccgacctctgctacgacgagtcggccacccgg
gccctgacccccgccgggcgcgccgcactccaggagctgagcgcggtgatccggaccagc
tacgacggtatacggctgcgcgccggagacctggccgtcgtggacaaccgggtcaccctg
cacggccggtcctccttcgtcccgcgcttcgacggaggggaccgctggctccagcggaca
ttcgccttcaccgatctgcgccggtcccgggaccaccggccggccgacggaaacgtgctg
gtgaagtga

DBGET integrated database retrieval system