KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2474Help
Entry
SHJG_2474         CDS       T02063                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00072  Synthesis and degradation of ketone bodies
shy00650  Butanoate metabolism
shy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SHJG_2474
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SHJG_2474
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SHJG_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR NAD_binding_10 RmlD_sub_bind 3Beta_HSD NmrA F420_oxidored 2-Hacid_dh_C THF_DHG_CYH_C ApbA
Motif
Other DBs
NCBI-ProteinID: AEY87749
UniProt: H2JZV1
Position
complement(2978162..2978983)
Genome map
AA seq 273 aa AA seqDB search
MTSPTPLPGPGPRSQPLSLDLGGRTALVTGAASGIGRACALRLAAAGAEVRAVDRDAAGL
AELAQQAERTDDLAGTVVPVAADLTDLDAAERAAAGTDVLVNNAGLQLVRPIEEFPPEVF
HTVLTVMLEAPFRLIRGALPHMYAQGWGRIVNVSSVHGLRASAFKSAYVAAKHGLEGLSK
TAALEGAAHGVTSNCVNPAYVRTPLVEKQIADQAQAHGIPEDRVLSEILLKDSAVRRLIE
PEEVAEAVAYLCSPQASFVTGTSLVLDGGWTAH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccaccccccttccggggcccggcccccgatcccagcccctcagcctcgac
ctcggcggccgcaccgccctcgtcaccggtgccgccagcggcatcggccgcgcctgcgcg
ctgcggctcgccgccgccggggccgaggtgcgcgccgtcgaccgggacgcggccggcctg
gccgagctggcccagcaggcggagcggaccgacgacctcgcgggcaccgtcgtccccgtg
gccgcggacctcaccgacctggacgccgccgaacgcgccgccgccggcaccgatgtgctg
gtcaacaatgccggcctgcaactcgtgcggcccatcgaggagtttccgcccgaggtgttc
cacacggtgctcaccgtgatgctggaggcacccttccgcctgatccgcggcgccctcccg
cacatgtacgcacagggctggggccggatcgtcaatgtgtcctccgtccatggtctgcgt
gcctcggccttcaagtccgcctatgtggccgccaaacatggcctcgaagggctgtccaag
acggccgccctggaaggcgccgcccatggagtgacctcgaactgtgtgaacccggcctat
gtgcgcaccccactggtcgagaagcagatcgccgaccaggcgcaggcgcacggcatcccc
gaggaccgcgtgctctccgagatcctgctgaaggacagcgccgtgcggcggctcatcgaa
cccgaggaggtcgccgaggccgtggcctacctgtgcagcccgcaggcgtccttcgtcacc
ggcacctcgctcgtcctggacggcgggtggaccgcccactga

DBGET integrated database retrieval system