KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3789Help
Entry
SHJG_3789         CDS       T02063                                 

Definition
(GenBank) hypothetical protein
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00860  Porphyrin and chlorophyll metabolism
shy01100  Metabolic pathways
shy03030  DNA replication
Module
shy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJG_3789
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SHJG_3789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shy03032]
    SHJG_3789
Enzymes [BR:shy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SHJG_3789
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SHJG_3789
DNA replication proteins [BR:shy03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     SHJG_3789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AEY89061
UniProt: H2K063
Position
complement(4384366..4385772)
Genome map
AA seq 468 aa AA seqDB search
MREFIVEADGGSRGNPGPAGYGAVVLDGATGEALTEAAEYIGVATNNVAEYRGLLAGLRA
AHALDPSARVHVRMDSKLVIEQMSGRWKIKHPDMKPLAAEARSVYPPDQVTYEWIPRERN
KHADRLANEAMDAGAKGRQWSPSRSGAVLDTPPAVPEPSGPPGDAAAGAAKARAALAEGR
TAGAAPVPEEAAPPSEQRAESPSEQHPTAPSAGQAPRAGQAPGEQRPESPSEGRPSSSGG
ETVDERRVTSAPGWSAAPDLGAPATLVLLRHGETPLTPQKRFSGSGGTDPSLSAAGREQA
HRVAEALARRGTIQAIVASPLARTRETAEIVAARLNLDVTLDDGLRETDFGAWEGLTFGE
VRERHPDDLDAWLADPEAHPTGGGESFAETATRIAATRDKLVAAHAGRTVLLVTHVTPIK
TFVRLALGAPPTSLFRMELSAASLSAVAYYADGNASVRLFNDTSHLRP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagttcatcgtcgaggccgacggcgggtcgcggggcaaccccgggcccgcgggc
tacggggcggtcgtgctcgacggggccacgggtgaggccctgaccgaggccgcggagtac
atcggcgtcgccacgaacaacgtcgccgagtaccgcggcctcctggccggcctccgcgcc
gcccacgccctcgacccgtcggcccgggtccacgtccgcatggactccaagctcgtcatc
gagcagatgtcgggccgctggaagatcaagcaccccgacatgaagccgctggcggcggag
gcgaggtccgtctaccccccggaccaggtcacctacgagtggatcccgcgcgagcggaac
aaacacgcggaccgcttggcgaacgaggcgatggacgcgggggcgaagggccggcagtgg
tcaccgtcgcggtccggcgcggtcctggacaccccgcccgccgtccctgagccgtcgggc
ccacccggagacgcggcggcgggcgcggcgaaggcccgcgcggccctggcggagggccgg
accgccggtgcggcgcccgtcccagaggaggcggcacctcccagcgagcagcgcgccgag
tcccccagcgagcagcaccccacggctcccagcgccgggcaggccccccgcgccgggcaa
gcccccggcgagcagcgccccgaatcccccagcgaagggcgcccctccagctccggtggg
gaaaccgtggacgagcggcgcgtcaccagtgcccccggctggagcgccgcccccgacctg
ggcgcgcccgccaccctcgtcctgctccggcacggcgaaacccccctgaccccccagaaa
cgcttctccggcagcggcggcaccgacccctccctctccgccgcgggccgcgagcaggcg
caccgggtcgccgaggcgctggcgcggcgcggcacgatccaggccatcgttgcctccccc
ctcgcccgcacccgcgagaccgccgagatcgtcgccgcccgcctgaacctggacgtcacg
ctcgacgacggcctgcgcgagacggacttcggcgcctgggagggcctgaccttcggcgag
gtccgcgagcgccacccggacgacctcgacgcctggctcgccgacccggaggcccacccc
accggcggcggcgagagcttcgccgagacggccacccggatcgccgcgacccgcgacaag
ctggtcgcggcccacgcgggccgtacggtcctgctggtcacccacgtcaccccgatcaag
accttcgtccgcctcgcgctcggcgccccgcccacgtcgctgttccggatggagctctcg
gcggcctccctgtcggcggtggcgtactacgcggacggcaacgcgagcgtacggctgttc
aacgacacctcccacctgcgcccctga

DBGET integrated database retrieval system