KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4825Help
Entry
SHJG_4825         CDS       T02063                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00260  Glycine, serine and threonine metabolism
shy00750  Vitamin B6 metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01230  Biosynthesis of amino acids
Module
shy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_4825
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SHJG_4825
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SHJG_4825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DNA_RNApol_7kD
Motif
Other DBs
NCBI-ProteinID: AEY90094
UniProt: H2JVT8
Position
complement(5551504..5552787)
Genome map
AA seq 427 aa AA seqDB search
MAVQTVATTSESTVDLGPAAALSCRECGHRVPLGPVFACEECFGPLEIAYDFSGYDTEEL
RRRIEAGPANIWRYAPLLPVPADVAGKPNINPGWTKLVQADNLARELGVTGGLYVKDDSG
NPTHSFKDRVVAQALEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQG
KIVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAEGSKTLAYEI
CEQLGWRLPDQIVVPIASGSQLTKIDKGLQELIKLGLVEDRPYKIFGAQAEGCSPVSTAF
KAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEEVVDAIKLLARTE
GIFAETAGGVTVGVTRKLLEAGVLDPAKTTVVLNTGDGLKTLDAVAGTGLTATIRPTLDS
FREAGLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagacagttgccaccaccagcgaatccaccgtcgacctcggccccgccgcg
gccctgagctgtcgcgagtgcggtcaccgggtgccgctcggcccggtcttcgcctgcgag
gagtgcttcggcccgctggagatcgcctacgacttctccggctacgacaccgaggaactg
cgccgccgcatcgaggcgggccccgcgaacatctggcgctacgcgcccctgctgccggta
ccggcggacgtcgccggcaagccgaacatcaacccgggctggaccaagctcgtccaggcc
gacaacctggcccgcgagctgggcgtgaccggcggtctgtacgtgaaggacgactccggc
aacccgacccactccttcaaggaccgggtcgtggcccaggccctggaggccgcccgcgcc
ttcggcttcaccaccctgtcctgctcctcgaccggcaacctggccggcgccgtcggcgcc
gccgccgcccgcgccggcttccgctcctgcgtgttcatcccgcacgacctggagcagggc
aagatcgtgatggccgcggtctacggcggtgaactcgtcggcatcgagggcaactacgac
gacgtgaaccgcttctgctccgagctgatcggcgacccggccggcgagggctggggcttc
gtcaacgtcaacctgcggccgtactacgcggagggctccaagaccctggcgtacgagatc
tgcgagcagctcggctggcggctgccggaccagatcgtggtcccgatcgcctccggctcc
cagctcacgaagatcgacaaggggctccaggagctgatcaagctcggtctggtcgaggac
aggccgtacaagatcttcggcgcccaggccgagggctgctccccggtctccaccgccttc
aaggccggccacgacgtcgtacggccccagaagccgaacaccatcgccaagtccctggcc
atcggcaacccggccgacgggccgtacgtcctggacatcgcgcgccgcaccggcggtgcc
gtggaggacgtgacggacgaggaggtcgtggacgcgatcaagctgctcgcgcggaccgag
ggcatcttcgcggagaccgccggcggcgtgaccgtcggcgtcacccgcaagctgctggag
gcgggcgtgctggacccggcgaagaccacggtcgtcctcaacaccggcgacggcctgaag
accctggacgcggtggccggcaccggcctcaccgccaccatccgcccgaccctggactcc
ttccgagaggctggcctcgcatga

DBGET integrated database retrieval system