KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4941Help
Entry
SHJG_4941         CDS       T02063                                 

Definition
(GenBank) phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Brite
KEGG Orthology (KO) [BR:shy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SHJG_4941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AEY90209
UniProt: H2JYP7
Position
5661870..5662868
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIAVALFFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSG
VAKTVSEGLIETPQGSTGMGILFAALLGAIVWNLVTWYFGLPSSSSHALFGGLVGAALAG
GTTVIWHGVVDKVIIPMFVSPVVGLIVGYLVMTAILWLFRRANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGVVVMALVISGHETYGDPIPVWVKIVCAIMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFTTAFLFKAPISTTHVITSAIMGVGATKRVNAVRWG
VAKNIILGWFITMPAAALVAALAFGLVKLVAL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttcgccctggtcgtgaccatcgcggtcgcgctcttcttcacgtacaccaac
ggtttccacgactcggcgaacgcgatcgcgacgtcggtgtcgacgcgggcgctgaccccg
cgggcggccctcgccatggccgccgtgatgaacctcgccggcgccttcctgggctccggc
gtcgccaagacggtcagcgagggtctgatcgagacgccccagggctcgaccggcatgggg
atcctcttcgcggccctgctcggcgcgatcgtctggaacctggtcacctggtacttcggc
ctgccgtcctcctcctcgcacgccctgttcggcggcctggtgggcgcggcgctggcgggc
ggtacgacggtgatctggcacggggtggtcgacaaggtcatcatcccgatgttcgtgtcc
ccggtcgtcggcctgatcgtcggctacctggtcatgacggcgatcctgtggctcttccgc
cgggccaacccgcacaaggccaagcgcggcttccgcatagcccagacggtctcggcggcc
ggcatggcgctgggccacggcctccaggacgcccagaagacgatgggtgtcgtcgtcatg
gcactggtgatttccggccatgagacgtacggcgacccgatcccggtctgggtgaagatc
gtctgcgcgatcatgctgtccctcggcacctacgcgggcggctggcggatcatgcgcacg
ctgggccgcaagatcatcgagctcgacccgccgcagggcttcgccgccgagacgaccggc
gcgtcgatcatgttcaccacggcgttcctcttcaaggcgccgatctccacgacccacgtc
atcacgtcggccatcatgggcgtgggcgcgaccaagcgcgtcaacgccgtccgctggggc
gtggccaagaacatcatcctcggctggttcatcacgatgccggcagcggccctggtggcc
gccctggccttcgggctggtcaagctggtggccctgtag

DBGET integrated database retrieval system